(data stored in SCRATCH zone)

EMBL: CP002105.PE41

CP002105.PE41        Location/Qualifiers
FT   CDS_pept        43161..44633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0041"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterProIPR015875:IPR001093:IPR000644:IPR013785:IPR
FT                   005990:IPR018529; KEGG: gwc:GWCH70_0009
FT                   inosine-5'-monophosphate dehydrogenase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; CBS domain containing protein;
FT                   PRIAM: IMP dehydrogenase; SMART: CBS domain containing
FT                   protein; SPTR: C5D335 Inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain; IMP dehydrogenase / GMP
FT                   reductase domain; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11593"
FT                   /db_xref="GOA:D9QSQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ5"
FT                   /protein_id="ADL11593.1"
FT                   /translation="MENKFEKEGLTFDDVLLIPAKSDVLPKEVDVSTHLTSDIELNTPI
FT                   LSAGMDTVTEAELAIAMAREGGIGIIHKNMSVEQQAEEVDKVKRSESGVIVNPFYLTPD
FT                   NFAYEAEHLMSKFKISGVPIVNNEEDMKLVGIITNRDLRFEKDFDQKLSEVMTKEGLVT
FT                   GPVGTTLEDAEDILQEYKIEKLPLVDDEYRLKGLITIKDIEKAEKYPNAAKDEQGRLLV
FT                   GAAVGTSRDTWSRIEALTDAGVDVIVIDTAHGHSTKVIDLVREIKEEYSKLNLIAGNVA
FT                   TAGATKDLIEAGADAIKVGIGPGSICTTRVVAGVGVPQITAVYDCAKEAEKFGVPVIAD
FT                   GGIKYSGDIVKALAAGASTVMLGSLLAGTKESPGEIEIYKGRSYKVYRGMGSVGAMKEG
FT                   SKDRYFQEEKKKLIPEGVEGRTPYKGELSDTIYQLVGGLRSGMGYCGAEDIETLKEEGK
FT                   FTRITGAGLRESHPHDIEVTKESPNYNLESRE"
     atggagaata aatttgaaaa agaaggactt acttttgatg atgtactctt gataccggct        60
     aaatctgatg tactacctaa agaagtagat gtgtctactc atttgacgtc tgatatagag       120
     ttgaatactc ccattttaag tgctggaatg gataccgtta ctgaggcaga actggctatt       180
     gccatggccc gcgaaggcgg tataggaatt attcataaga atatgtctgt tgaacagcag       240
     gctgaggaag ttgataaggt aaaaagatca gagagcggag taatagttaa tccattttat       300
     ttaactcctg ataattttgc ttatgaagct gaacatttaa tgtctaaatt taagatttct       360
     ggagtaccga ttgttaataa tgaggaagat atgaaattag taggaattat aaccaaccgt       420
     gatttgagat ttgaaaagga ttttgatcag aagctttcag aagttatgac taaagagggg       480
     ctcgttactg gaccagtagg gactacatta gaagatgctg aggatattct acaggagtat       540
     aagattgaaa agctgccgtt agttgatgat gaatatcggt taaagggatt aattacaatt       600
     aaggatatag agaaggctga aaagtatcct aatgctgcta aagatgagca agggcgtctt       660
     ttagttggag cagctgtagg aacatcacgt gatacttgga gtcggattga agcattgact       720
     gatgctggag tagatgtaat agttattgat acagctcatg gacattctac taaagtaatt       780
     gatttggtaa gggagattaa agaggaatat tctaaattaa atttaattgc tggtaatgtt       840
     gctactgctg gagcaactaa ggatttaatt gaagcaggtg cagatgcaat taaggtaggt       900
     atcggtcctg ggtctatctg tacgacaaga gttgtagcag gagttggggt acctcagatt       960
     acagcagttt atgactgtgc taaagaggcg gagaagtttg gtgtaccggt gattgctgac      1020
     ggaggaatca agtattctgg tgatattgtt aaagctttag cagctggtgc tagtactgta      1080
     atgttaggca gtctgttagc aggaactaaa gagagccctg gtgaaataga gatctataaa      1140
     ggaagaagct ataaagttta tcgcggaatg ggctctgttg gagctatgaa agaaggtagt      1200
     aaagaccgtt attttcagga agaaaagaag aaattaattc cggaaggtgt tgaaggaaga      1260
     actccttata aaggcgaatt atcagatact atttatcaat tagtaggtgg tctgcgatcc      1320
     ggtatgggat actgtggagc tgaagatata gaaacattaa aagaagaagg taaattcact      1380
     agaattactg gagctggttt aagagagagt catcctcatg atatagaagt tactaaagaa      1440
     tcacctaatt ataatttaga atcaagagaa taa                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page