(data stored in SCRATCH zone)

EMBL: CP002105.PE412

CP002105.PE412       Location/Qualifiers
FT   CDS_pept        459594..460622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0417"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="COGs: COG1559 periplasmic solute-binding protein;
FT                   InterPro IPR003770; KEGG: hor:Hore_05820
FT                   aminodeoxychorismate lyase; PFAM: aminodeoxychorismate
FT                   lyase; SPTR: B8D2B2 Aminodeoxychorismate lyase; PFAM:
FT                   YceG-like family; TIGRFAM: conserved hypothetical protein
FT                   TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11964"
FT                   /db_xref="GOA:D9QUQ5"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUQ5"
FT                   /protein_id="ADL11964.1"
FT                   /translation="MFDFQSRNRNLAAVVIMILFILTLTSISYLQKWTGPVDRGAVSAY
FT                   EVEVKSGASSGQIANLLFEKKLIRHPFLFKALVRFKGVENKLRAGYYRLSTGMSIDEMI
FT                   DKLVSNEVITYQVTIPEGYTVEEIGDKLSKKAGFSKKQFLTVAEELKAEFSFAEEIDVK
FT                   HRKYPLEGYLFPETYSIPKGTAPENIIKLMVGQFKEKLIDKLITEVKQSKYSLDEIITI
FT                   ASLVEAEVKYDKERRLIAGVIHNRLNKNMLLQIDATIQYILPEHKEQILYKDLALDSPY
FT                   NTYQRLGLPPGPINNPGLASIRAALNPAETDYLYYFALEDGSHKFSETYQEHLRLQNKL
FT                   KY"
     ttgtttgatt ttcaatcgcg taatagaaat ttagcagctg tggtgattat gattcttttt        60
     attttaacgc tgactagcat ttcttatctc cagaaatgga cagggccggt ggatagagga       120
     gcggtttctg cttatgaagt tgaggttaag tcaggggcta gcagcggtca gatagctaac       180
     ttgttatttg aaaagaaatt aattagacat ccgtttcttt ttaaggcatt ggttagattc       240
     aagggagttg agaataagct gcgggcgggc tattatagat taagcacagg tatgtcgatt       300
     gatgaaatga tagataagtt agttagtaat gaggtgatta cttatcaggt aactattccg       360
     gaaggatata ctgtcgaaga gattggggat aaattatcta aaaaggctgg ctttagtaag       420
     aagcagtttc ttacggtagc ggaagaatta aaggctgaat tttcttttgc cgaagagata       480
     gatgttaagc atcggaaata tccgttagag ggctatctgt ttccggagac ttactcaatt       540
     ccgaagggga ctgctccgga gaatataatt aagttgatgg tggggcaatt taaggagaag       600
     ttaattgata aattaataac agaggtgaag cagagcaagt atagtctgga tgagataata       660
     acaattgctt ctttagtgga agcagaggta aagtatgata aggagcggcg gttgattgca       720
     ggcgtgatcc ataaccggct gaataaaaat atgttactcc agatagatgc tactattcaa       780
     tacattctgc cggagcataa agagcagatt ctttataaag atttagcttt ggattcgccg       840
     tataatacct atcaacgttt aggcttaccg ccggggccga tcaataatcc ggggctggct       900
     tcgattaggg cagcactcaa tcctgctgag acggattact tatattactt tgctttagag       960
     gatgggagcc ataaatttag tgagacttat caggagcatc tgcggctgca gaataagttg      1020
     aaatattaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page