(data stored in SCRATCH zone)

EMBL: CP002105.PE419

CP002105.PE419       Location/Qualifiers
FT   CDS_pept        466884..467591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0425"
FT                   /product="RNA polymerase, sigma 27/28 subunit, RpsK/SigK"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit;
FT                   InterProIPR011991:IPR000943:IPR013325:IPR013324:IPR
FT                   014209:IPR014284:IPR016263:IPR007627:IPR007630; KEGG:
FT                   hor:Hore_05860 sporulation sigma factor SigK; PFAM:
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; SPTR: B8D2B6 RNA polymerase sigma factor; TIGRFAM:
FT                   RNA polymerase sigma-K factor; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   RNA polymerase sigma-K factor"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11971"
FT                   /db_xref="GOA:D9QUR2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014209"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUR2"
FT                   /protein_id="ADL11971.1"
FT                   /translation="MIPGFLAGIGSSLADGILVLISYIANNNIFPQPLDDEEEKKYLTR
FT                   YLEGDEEAKEVLIEHNMRLVAHIVKKYNNSNVDKEDLISIGSIGLIKAIETYDPSKKVK
FT                   LATYASRCIENEILMHFRQNKKTNREVKLHDPLSSDKEGNEMTLMDVYETDEEAVLEKV
FT                   EMALAEERLYDKIEGLSEREQKVVKMRYGLNNVEELTQREIANKLGISRSYVSRIEKRA
FT                   LQKLNQLFCTNGG"
     atgatacctg gctttctggc tggaatagga agcagcttgg ccgatggtat tttagttttg        60
     atttcttata ttgccaataa taatatcttt cctcagccgc tggatgatga agaagaaaag       120
     aaatatttaa cacgttattt agaaggggat gaagaagcaa aagaggtttt gattgagcat       180
     aatatgcgtt tggtagccca tattgtaaaa aagtataata actctaatgt agataaagaa       240
     gacttgatct ctatcggttc tattggattg attaaggcta ttgaaactta tgatccatct       300
     aaaaaagtca agttagctac ttatgcttcc cgctgtatag agaatgaaat tctgatgcat       360
     tttagacaga ataaaaagac taatcgcgaa gtaaaacttc atgatccgct tagttcagat       420
     aaagaaggaa atgaaatgac tctaatggat gtttatgaaa ctgatgagga agcagtttta       480
     gagaaagtag agatggcttt agcagaagaa agattatatg ataagattga aggcttaagt       540
     gagcgcgaac agaaagtagt aaagatgaga tatggtttaa ataatgttga agagcttaca       600
     cagcgggaga tagccaataa attaggaatt tcacggtctt atgtttctcg aattgaaaag       660
     agagcgctcc aaaagttgaa tcaattattc tgtactaatg gaggttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page