(data stored in SCRATCH zone)

EMBL: CP002105.PE422

CP002105.PE422       Location/Qualifiers
FT   CDS_pept        469345..469755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0428"
FT                   /product="transposase IS200-family protein"
FT                   /note="COGs: COG1943 Transposase and inactivated
FT                   derivatives; InterPro IPR002686; KEGG: mma:MM_3037
FT                   transposase; PFAM: transposase IS200-family protein; SPTR:
FT                   Q8PRR7 Transposase; PFAM: Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11974"
FT                   /db_xref="GOA:D9QUR5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUR5"
FT                   /protein_id="ADL11974.1"
FT                   /translation="MSNQNNLIHARTCVYNVGYHIVFTVKCRKKVLTGKVATRLKEVLH
FT                   QVAQDKEFIIETMELMPDYVDLFVTAHPKIAPSYIVKMSKGISGRLLLKEFPKLKEELY
FT                   KGHLWNKSYYLETVGSISKDTVKQYIENQKSK"
     ttgagtaacc aaaataatct aattcatgct agaacatgtg tttataatgt tggctatcac        60
     attgtattta cagttaaatg tcgaaagaaa gtattaactg gtaaagtagc tactagatta       120
     aaagaagtat tacatcaagt tgctcaggat aaagagttta ttattgaaac tatggagtta       180
     atgcctgact atgtagattt atttgtaact gctcacccta aaatagctcc tagttatatt       240
     gttaaaatga gtaaaggtat tagcggtaga ttattattaa aagaatttcc taaattaaaa       300
     gaggagttat ataaaggaca tttatggaat aaatcttatt atctagaaac tgtaggtagt       360
     atttctaagg atactgttaa gcaatatatt gaaaatcaaa aatctaaata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page