(data stored in SCRATCH zone)

EMBL: CP002105.PE429

CP002105.PE429       Location/Qualifiers
FT   CDS_pept        474701..475528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0435"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4176 ABC-type proline/glycine betaine
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: mac:MA2146 glycine betaine/L-proline ABC transporter,
FT                   permease; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: B1BAC8 Glycine betaine
FT                   transport system permease protein opuAB; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11981"
FT                   /db_xref="GOA:D9QUS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUS2"
FT                   /protein_id="ADL11981.1"
FT                   /translation="MNLPIGKGVELLLDVLLNNFGPFFEIVSNLVEQFMTGFTNLLLVA
FT                   PPLVVILALTGLALLIADKKVAFFSFIGLFVVFGMGLWVATIRTFVLVFVAAVIALALG
FT                   IPTGILINKSQLLNRIITPILDFMQTMPPFVYLIPATMFFGIGNVPGVMATVIFAMPPA
FT                   IRLTDLGLKQVPDELEEVGFAFGSTPWQMLFKVRLPLALPSIMAGINQCIMLSLSMVVI
FT                   ASMIGAKGLGAEVLNGIQRMQIGVGFEAGLGVVILAIILDRITKGLNQVNAEQ"
     atgaatttgc ctataggcaa aggagtagaa ttattattag atgtactttt gaataatttt        60
     ggacctttct ttgaaatagt atcaaattta gtggagcaat ttatgactgg atttacaaat       120
     ttacttttag tagctccacc tttagttgtt attttagctt taaccggttt agctttatta       180
     atagccgata agaaggtagc tttcttcagt tttattggtc tttttgtagt atttggtatg       240
     ggattgtggg tagctactat acgtactttt gtcttagttt ttgttgcagc tgtaattgcg       300
     ctagctttag gaattccaac aggaattttg attaataaga gtcaattatt gaatagaata       360
     attaccccca ttttagactt tatgcagact atgcctccgt ttgtttactt aatcccagcc       420
     actatgttct ttggaattgg taatgttcct ggagtaatgg ctacagttat ttttgcaatg       480
     cctccagcga ttagattaac tgatttgggc ctaaaacaag taccagatga actagaagaa       540
     gtaggatttg cttttgggtc tactccatgg cagatgttgt ttaaagttag gttacctcta       600
     gcattacctt caattatggc ggggattaat caatgtatta tgctttcctt atctatggtt       660
     gttatagctt ctatgattgg agctaaaggt ctaggagctg aagtgttgaa tggaattcaa       720
     aggatgcaga ttggagttgg atttgaagct ggattaggag tagttatttt ggctattatt       780
     ttagatagaa ttactaaggg attgaatcag gttaacgcgg agcaataa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page