(data stored in SCRATCH zone)

EMBL: CP002105.PE43

CP002105.PE43        Location/Qualifiers
FT   CDS_pept        45413..45868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0043"
FT                   /product="protein of unknown function DUF327"
FT                   /note="COGs: COG1728 conserved hypothetical protein;
FT                   InterPro IPR005585; KEGG: hor:Hore_15530 hypothetical
FT                   protein; PFAM: protein of unknown function DUF327; SPTR:
FT                   C6Q6P9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF327)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11595"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ7"
FT                   /protein_id="ADL11595.1"
FT                   /translation="MKIQNDLKKDLNQLLNKSKLQTSESVKSSDNKFLDTLQEVHDANT
FT                   KERLDELLGQIDKQGERLSQKRTFKELVRYKKMVQQFVKEAVEKMYRVKEEFSTYGSGN
FT                   HKVYNLVVKVDESLEELTELVLDKQSTQLEILDRLDEVRGMLVDIYT"
     atgaagattc agaatgattt aaagaaggac cttaatcagc tccttaataa atctaagtta        60
     cagacttctg agtcagtcaa aagcagtgat aataaatttt tggatactct tcaggaagtc       120
     catgatgcta atacaaaaga aagactggat gaattattgg gacagataga taaacagggt       180
     gaacggttga gccaaaaacg aacatttaaa gaattagttc gttataaaaa gatggttcag       240
     cagtttgtta aggaagcagt agaaaaaatg tacagagtaa aagaggagtt tagtacttat       300
     ggaagcggga atcataaagt atataatcta gtggtaaaag ttgatgagtc actggaggaa       360
     ttaacagaat tagtcttgga taaacagtca actcagctgg agatacttga ccgtcttgat       420
     gaagtacgtg gtatgttagt tgatatctat acttaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page