(data stored in SCRATCH zone)

EMBL: CP002105.PE446

CP002105.PE446       Location/Qualifiers
FT   CDS_pept        495196..496119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0452"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="COGs: COG0280 Phosphotransacetylase; InterPro
FT                   IPR012147:IPR002505; KEGG: rde:RD1_0842 phosphate
FT                   butyryltransferase, putative; PFAM: phosphate
FT                   acetyl/butaryl transferase; PRIAM: Phosphate
FT                   butyryltransferase; SPTR: C0CQB5 Putative uncharacterized
FT                   protein; PFAM: Phosphate acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11998"
FT                   /db_xref="GOA:D9QUT9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUT9"
FT                   /protein_id="ADL11998.1"
FT                   /translation="MAIKTFEELKEAVVKLEPIRVAVAAAGDEKVVGGVKLAQELGIIK
FT                   EPVLTGDAEKIKEIVDAQEAEVTADNIRDAVDDSQAARLAVKAVNDGEVQALAKGRLET
FT                   LHYLRAILDKETGIRAAKVLNNLTLFEMDSYHKLVGVSDNAIMPNPDLEDKKAIIENTK
FT                   PLWTALGIEQPKAAVLAAVEIVNDKMQATVDGCCLTRMVDRGQIKDFIVDGPLSYDIAM
FT                   SLECAKGKNLADSKVAGDPDLLVLPNLESANMLGKSYKLHGKAESGGLVFGAEVPVMLN
FT                   SRSDSAERRLNAILMARAIAEKTSLV"
     atggctatta aaacctttga agaattaaaa gaagcagtag ttaagttaga accgattaga        60
     gtagcagtag ctgctgctgg agatgagaaa gtagtcggtg gagttaagct agctcaagaa       120
     ttaggaatta ttaaagaacc ggttttaacg ggagatgctg agaagataaa agagattgtg       180
     gatgctcagg aagcagaagt aacagcagat aatattcgtg atgctgtaga cgatagtcaa       240
     gcagctcggt tggcagtaaa ggctgttaat gatggtgaag tgcaggcttt agctaaaggt       300
     agattggaga cactgcacta tttaagagct attcttgata aagagacagg aattagagca       360
     gctaaagttt tgaataatct tacgttattt gaaatggata gctaccataa gttagtcggt       420
     gtcagtgata atgcaattat gcccaatccc gatttagaag ataagaaggc aattatcgaa       480
     aatactaagc cgctatggac ggcattagga attgagcagc cgaaagcggc agtgttagcg       540
     gctgtggaaa tagttaatga taagatgcag gcgaccgtag atggttgctg tttaacaagg       600
     atggtagatc ggggacagat aaaagatttt attgtagatg gccccctatc ctatgatatt       660
     gcaatgagct tagaatgcgc taaaggtaaa aatctagcag attccaaggt ggctggagat       720
     cctgatttat tggtacttcc taatttagaa tcagctaata tgctaggtaa gagttataaa       780
     ttgcatggta aagctgaatc tggtggatta gtatttggag ctgaagttcc agtaatgtta       840
     aattctcgtt ctgattctgc tgaaaggcga ttgaatgcta ttttaatggc ccgagcgatt       900
     gctgaaaaaa cttctctagt ttaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page