(data stored in SCRATCH zone)

EMBL: CP002105.PE451

CP002105.PE451       Location/Qualifiers
FT   CDS_pept        498924..499400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0457"
FT                   /product="purine hydroxylase delta subunit apoprotein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR012675:IPR006058:IPR001041:IPR002888; KEGG:
FT                   pmo:Pmob_1739 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein; PFAM: [2Fe-2S]-binding domain
FT                   protein; ferredoxin; SPTR: A9BIU4 (2Fe-2S)-binding domain
FT                   protein; PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12003"
FT                   /db_xref="GOA:D9QUU4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUU4"
FT                   /protein_id="ADL12003.1"
FT                   /translation="MVNEIALTVNGTKYELAVKGHQTLADVLRDELGLIGTKVGCGEGE
FT                   CGACTVMVDGRTVTSCLMLAAQADGCEIITIEGLAEDAEGELHPVQEAFVEAGAIQCGF
FT                   CTPGFVMSTVALLEEYPDPTEEQIREGLAGNLCRCTGYQQIFDAVELAKEKREV"
     gtggttaatg agattgcttt aacagtaaat ggtacaaaat atgagttggc tgtaaaaggt        60
     caccagactc ttgctgacgt tctaagagat gagctaggat taatcggaac taaggttgga       120
     tgcggcgagg gagaatgcgg agcctgcaca gttatggtag atggtagaac cgtgacctcc       180
     tgtttaatgc ttgctgcgca ggctgatgga tgtgaaataa taactattga aggattagct       240
     gaagatgctg aaggcgagtt acatccagta caagaggctt ttgtagaagc aggagctatt       300
     cagtgtggtt tctgtactcc aggatttgta atgtcaacag tagccttatt ggaagaatat       360
     cctgatccaa cagaagaaca aattagggaa ggtttagctg gtaatttgtg tagatgcact       420
     ggataccagc agatattcga tgcagtagag ttagctaaag aaaaaaggga ggtgtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page