(data stored in SCRATCH zone)

EMBL: CP002105.PE453

CP002105.PE453       Location/Qualifiers
FT   CDS_pept        501761..502627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0459"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs;
FT                   InterProIPR016167:IPR016169:IPR005107:IPR016166:IPR 002346;
FT                   KEGG: dka:DKAM_0739 molybdopterin dehydrogenase
FT                   FAD-binding; PFAM: molybdopterin dehydrogenase FAD-binding;
FT                   CO dehydrogenase flavoprotein domain protein; SPTR: B8D4N4
FT                   Molybdopterin dehydrogenase FAD-binding; PFAM: FAD binding
FT                   domain in molybdopterin dehydrogenase; CO dehydrogenase
FT                   flavoprotein C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12005"
FT                   /db_xref="GOA:D9QUU6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUU6"
FT                   /protein_id="ADL12005.1"
FT                   /translation="MRSFDYYRADTVDEAISLLQKFNGEAVLLAGGTDVIVEAKEEGVE
FT                   FERVVDISRTDELRGISLEGDKIHIGAATKFYEIVDSEIVRENAGVLARAANKVGSVQT
FT                   RNMGTIGGNVGNAAPSADSLPSLLILDAQVVVADPEGEKCVPVNEIFEGPGETVLNSLQ
FT                   MIKEIIIPCVPENTGMKYIKHMRRKAMDVATVGCAVRVGINPQSKKMTDVYIALGSVAP
FT                   TPILVEGITDKAQGKKLDQDLAQEIGEFAMNQVSPITDVRSTKEYRNEMVKTLVKNALM
FT                   EAYDNVI"
     atgaggtcat ttgattacta tagggctgat acggttgatg aagcaataag tttattacaa        60
     aagtttaatg gtgaagctgt tttattagct ggaggaacag atgttatagt agaagcgaaa       120
     gaagagggtg tcgagtttga acgagttgtt gatattagta ggaccgatga attaagagga       180
     atttcgttag agggagataa aattcatatt ggagcagcaa ctaagttcta tgaaattgtt       240
     gattctgaaa tagtgagaga aaatgcagga gttttagctc gggctgctaa taaagtagga       300
     tcagtgcaga cgagaaatat gggaacaata ggtggaaatg taggaaatgc ggctccatca       360
     gcagactccc taccttcttt attaatatta gatgctcaag tagtagtagc tgatccagaa       420
     ggagaaaaat gtgtgccagt aaatgaaatc tttgaagggc caggagaaac agtattgaat       480
     tcactacaga tgattaaaga aattataatt ccctgtgtac ctgaaaatac gggaatgaaa       540
     tatataaaac atatgcgtag aaaagcaatg gatgttgcaa cggtaggatg tgcagttaga       600
     gttggtatta atccgcagag taaaaagatg acagatgttt atattgcttt aggatctgta       660
     gctccaacac cgatcttagt tgaaggaata acagataaag ctcaaggaaa gaagcttgat       720
     caagatttag ctcaagaaat tggagaattt gctatgaatc aagtttctcc gattactgat       780
     gtaagaagta ctaaagaata taggaatgaa atggttaaaa cgttagtgaa aaatgcttta       840
     atggaagctt atgataatgt aatttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page