(data stored in SCRATCH zone)

EMBL: CP002105.PE46

CP002105.PE46        Location/Qualifiers
FT   CDS_pept        47911..48261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0046"
FT                   /product="protein of unknown function DUF972"
FT                   /note="COGs: COG4467 conserved hypothetical protein;
FT                   InterPro IPR010377; KEGG: hor:Hore_20340 hypothetical
FT                   protein; PFAM: protein of unknown function DUF972; SPTR:
FT                   B8CZS7 Uncharacterized protein conserved in bacteria; PFAM:
FT                   Protein of unknown function (DUF972)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11598"
FT                   /db_xref="GOA:D9QSR0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR0"
FT                   /protein_id="ADL11598.1"
FT                   /translation="MEEILSLLATFQEKLNMLNDDFQKIKKITHRLYKENEELKEENEN
FT                   LKRLLFEQKAENEEEPEAREGYNNLAKLYEEGFHICHLNFGEKRDGECLFCMGLLDIQL
FT                   DSEVEADKVVQD"
     gtggaggaaa ttttaagtct attagctact tttcaggaaa aactgaatat gttaaatgat        60
     gatttccaga agataaagaa gattacgcat agattatata aagagaacga agagctaaag       120
     gaagagaatg agaatttaaa gcggctgctt tttgagcaga aagcagaaaa tgaagaagaa       180
     cctgaagcta gggaaggata taataattta gctaaattat atgaagaggg atttcatatt       240
     tgtcatctta attttggtga aaaacgggat ggagaatgtc tcttctgcat ggggcttttg       300
     gatattcaac tagattctga agttgaggct gataaagttg tccaggattg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page