(data stored in SCRATCH zone)

EMBL: CP002105.PE460

CP002105.PE460       Location/Qualifiers
FT   CDS_pept        508456..509481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0466"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR001453; KEGG: chy:CHY_0621
FT                   molybdopterin-binding domain-containing protein; PFAM:
FT                   molybdopterin binding domain; SPTR: Q3AEF7
FT                   Molybdopterin-binding domain protein; PFAM: Probable
FT                   molybdopterin binding domain; TIGRFAM: molybdenum cofactor
FT                   synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12012"
FT                   /db_xref="GOA:D9QUV3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUV3"
FT                   /protein_id="ADL12012.1"
FT                   /translation="MEIKEIPVEEAVGRVVAHDMTQIIPQEFKGARFQKGDVIDSKDIS
FT                   TLKDMGKEHIYVLSLDEGTIHEDDAACQIAKKVVGKNIVLSEANEGKINLKAEQKGILK
FT                   VDKDLLLDVNSIDEILITSSHDNIFLQAGDSLAGVRINPLTIEERKLKQFEAILGDQNL
FT                   FGIEPFVDKKVGVVVTGNEVYSGRIEDEFVPTLQRKFKRWGGELLDSIIVPDEVDEITE
FT                   ALSNLKESGAEVLITGGGMSVDPDDLTPKGIRNTGAEIVKYGVPVLPGNKLMLAYWDGI
FT                   PVLGLPACVIFEEITVFDLIYPRLLTGEEFTRNDLIELSYGGYCYHCDVCQFPQCSFGK
FT                   I"
     atggaaatta aagagatacc agttgaagag gcagttggta gagtagtagc tcatgatatg        60
     actcagatta tccctcaaga atttaaaggg gctagatttc aaaaagggga tgtgattgac       120
     agtaaggata tatctacttt aaaggatatg ggaaaagagc atatatatgt cctttcttta       180
     gatgaaggaa ctattcatga agatgatgca gcttgtcaaa ttgctaagaa agtagttggt       240
     aaaaatattg ttttatcaga agcaaatgag ggtaaaatta acctcaaggc agagcaaaaa       300
     ggtattctta aggtagataa ggatttgctt ttagatgtta acagtattga tgaaattctt       360
     attacttcta gtcatgataa cattttttta caggcaggag attcattagc tggagtaaga       420
     attaatcctt taacaattga agagaggaag ctgaaacaat ttgaagctat tttaggtgac       480
     caaaaccttt ttgggataga accctttgtt gacaagaaag taggtgtagt agttactgga       540
     aatgaggtct atagtggacg aattgaagat gaatttgtgc caaccttaca gagaaagttt       600
     aaacgttggg ggggcgagtt gttagattca attattgtcc ctgatgaagt agatgagatt       660
     acagaggcat tgtctaactt aaaagaatct ggagcagaag tattaattac cggaggagga       720
     atgtcagttg atcctgatga tttgacccca aagggaataa gaaatactgg agctgaaatt       780
     gttaagtatg gtgtgccagt attgcctgga aataaattaa tgttggctta ttgggatggt       840
     atacctgtac taggtttacc ggcttgtgtt atttttgagg aaattactgt ctttgatctt       900
     atttatcccc gtcttttaac tggagaagaa ttcacaagaa atgatttgat agaattaagt       960
     tatggtggat attgttatca ttgtgatgta tgtcagtttc ctcagtgttc ttttggtaaa      1020
     atttaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page