(data stored in SCRATCH zone)

EMBL: CP002105.PE462

CP002105.PE462       Location/Qualifiers
FT   CDS_pept        510360..510683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0468"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777;
FT                   KEGG: nth:Nther_2211 protein of unknown function DUF182;
FT                   PFAM: protein of unknown function DUF182; SPTR: C4CGJ9
FT                   Predicted sulfurylase small subunit, molybdopterin cytosine
FT                   dinucleotide biosynthesis; PFAM: XdhC and CoxI family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12014"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUV5"
FT                   /protein_id="ADL12014.1"
FT                   /translation="MDREIVNKIKSYEGEGDYIALATVISAAGSSPRNIGAQMLVYPNG
FT                   AISGTVGGGISEAETIEKAQELIKTGKNKKYFFDMSNQEVAKSGGVCGGQVAIFIETIK
FT                   INN"
     atggacagag agatagtaaa taagattaaa agttatgaag gagaagggga ttatatagct        60
     cttgctactg ttatttcagc tgcaggttct tcaccgagaa atattggagc acaaatgtta       120
     gtttatccta atggtgctat tagtggtacc gttggaggag gtatatctga agcagagact       180
     attgaaaaag cacaagagtt aataaaaaca ggaaagaata aaaaatattt ttttgatatg       240
     agtaatcagg aagtagccaa atctggtgga gtctgtggtg gacaagttgc aatttttatt       300
     gaaactataa agataaataa ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page