(data stored in SCRATCH zone)

EMBL: CP002105.PE464

CP002105.PE464       Location/Qualifiers
FT   CDS_pept        511516..512307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0470"
FT                   /product="NifC-like ABC-type porter"
FT                   /note="COGs: COG0555 ABC-type sulfate transport system
FT                   permease component; InterPro IPR000515:IPR006469:IPR011867;
FT                   KEGG: dae:Dtox_3448 NifC-like ABC-type porter; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1T8I6 NifC-like ABC-type porter; TIGRFAM:
FT                   NifC-like ABC-type porter; molybdate ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: molybdate ABC
FT                   transporter, permease protein; NifC-like ABC-type porter"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12016"
FT                   /db_xref="GOA:D9QUV7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUV7"
FT                   /protein_id="ADL12016.1"
FT                   /translation="MKFNYFKVIMFIVFIVFIVFLTTVLFTPLIYIKGATLLSVLVNNQ
FT                   EVYYALSLSLLTSLISILLATIISLPVGYVLARYDFRGKKVFDILLDLPIILPPLVMGL
FT                   SLLILLGPVLGDQLAKLGIKFVFTPLGVVMAQFIVATPFTIRSFKTAFIEIDPNLEKAA
FT                   MTLGDSYFQVFRRITLPLAKNGIVSGITLAWARAMGEFGATVMLAGATRLKTETLPIAI
FT                   FLNISTGDMDVAISISLIMIIFSIIVLGVLKTFDKGVDERF"
     atgaaattta attattttaa agtaataatg tttattgttt ttattgtttt tatagttttt        60
     ttaactactg tattatttac tcccttgata tatatcaagg gagcaacatt attatcagtt       120
     ttagttaata atcaagaagt ttattatgct ttatctttaa gcttgcttac atcattaatt       180
     tctattttgt tagctactat aatctcctta cctgttggtt atgtattagc tagatatgat       240
     tttagaggta aaaaagtatt tgatattttg ctagatttac caattattct gcccccttta       300
     gtgatgggac tgagtttatt aatcttgtta gggccagtat taggagatca attagctaaa       360
     ttaggaatta aatttgtttt tacgcccttg ggagtagtaa tggcccagtt tatagtggct       420
     acgcctttta ctattcgaag ttttaagaca gcttttattg agattgatcc taacttagaa       480
     aaggcagcaa tgactttagg tgattcttat tttcaagtat ttagaagaat tactcttccc       540
     ttagctaaaa atggtattgt atcagggatt actttagcct gggctagggc aatgggagaa       600
     tttggagcta cagtaatgtt agctggagcg actcggttga agactgagac gttgcctatt       660
     gctatttttt taaatatttc aactggtgat atggatgtgg ctatttctat ttctttaatt       720
     atgattattt tttctattat tgttttagga gtattaaaga cttttgataa aggagttgat       780
     gaaagatttt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page