(data stored in SCRATCH zone)

EMBL: CP002105.PE465

CP002105.PE465       Location/Qualifiers
FT   CDS_pept        512440..512733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0471"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008995; KEGG: mma:MM_1563 tungsten
FT                   transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12017"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUV8"
FT                   /protein_id="ADL12017.1"
FT                   /translation="MTSQVVPSEENWIEKIAILPEDIYISDTKPPGPNINRIKGKLTRV
FT                   EEDSAYVNCIVKTDREIKIKVLPEVFNSMNLSINDQVWLVFNLRKIKVLNGS"
     gtgacatctc aggtagtacc aagtgaggag aattggatag aaaagattgc tattctacct        60
     gaagatatat atatttctga tactaagcca cctggaccga acataaatag aatcaaaggt       120
     aagttaacta gagtcgaaga agattctgct tatgttaact gtattgtcaa aacggacaga       180
     gagataaaga ttaaagtttt gccggaagtc tttaacagta tgaacttaag tattaatgac       240
     caagtttggt tagttttcaa tttaaggaaa attaaagtct taaatggaag ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page