(data stored in SCRATCH zone)

EMBL: CP002105.PE467

CP002105.PE467       Location/Qualifiers
FT   CDS_pept        513562..514380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0473"
FT                   /product="selenium-dependent molybdenum hydroxylase system
FT                   protein, YqeB family"
FT                   /note="InterPro IPR017695; KEGG: nth:Nther_2210
FT                   biotin/lipoyl attachment; SPTR: B2A804 Biotin/lipoyl
FT                   attachment; TIGRFAM: selenium-dependent molybdenum
FT                   hydroxylase system protein, YqeB family; TIGRFAM:
FT                   selenium-dependent molybdenum hydroxylase system protein,
FT                   YqeB family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12019"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUW0"
FT                   /protein_id="ADL12019.1"
FT                   /translation="MIKEISNISDIKVLIKGGGDLATGIAYRLFQSGFTVACSELDEPS
FT                   MVRRTVSFGEAVYQGEWEVEGIKARLINNKREFEQTVNDRNIPVFIADKMSLFKEVLSP
FT                   QVIVDARMLKRVNDTVINEAPIVIGCGPGFSANSDVDAVVETNRGHYLGRVIYSGSAQD
FT                   NTGVPGEIMGYARERVLFAPGSGVFTSSKKIGDEIKAGEEFGKVNDKVVSAAISGVIRG
FT                   QIYPGIKVKEGMKIGDIDPRNKNDHCYTISDKALAIGGGVLEAILNLLNR"
     atgattaaag agattagtaa tatatcagat attaaggttt tgattaaagg gggaggagat        60
     ttagctactg gaattgctta taggcttttt caaagcggtt ttactgtagc ttgtagtgaa       120
     ttagatgaac catcaatggt aaggagaact gtttcttttg gagaagcagt ctatcaaggt       180
     gagtgggaag tagaaggaat taaggctagg cttattaata ataaaagaga gtttgaacaa       240
     acggtaaatg ataggaatat tccagtcttt attgctgata aaatgtcatt atttaaagaa       300
     gttttgtccc cgcaggtaat agttgatgct agaatgttaa aaagagtaaa tgatacagtc       360
     ataaatgagg caccaattgt gattggttgt ggtccaggtt ttagtgctaa tagtgatgtt       420
     gatgctgtgg ttgaaactaa ccgaggacat tatttaggac gggtgattta ttcaggtagt       480
     gctcaggata atactggtgt tcctggtgaa atcatgggat atgcacgaga acgagtactg       540
     tttgctcctg gtagtggggt tttcactagc agtaaaaaaa ttggagatga aattaaagca       600
     ggagaagagt ttgggaaagt aaatgataaa gttgttagtg cagctattag tggggttatt       660
     cgtggacaaa tatatcccgg tattaaagta aaggaaggga tgaagattgg tgatattgat       720
     ccacgaaata agaatgacca ttgttataca atttctgata aagccttagc aattggtggt       780
     ggagtcctgg aagcaatttt gaatttgtta aatagatag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page