(data stored in SCRATCH zone)

EMBL: CP002105.PE471

CP002105.PE471       Location/Qualifiers
FT   CDS_pept        516812..517228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0477"
FT                   /product="glutamate mutase subunit S"
FT                   /EC_number="5.4.99.1"
FT                   /note="COGs: COG2185 Methylmalonyl-CoA mutase C-terminal
FT                   domain/subunit (cobalamin-binding); InterPro
FT                   IPR006158:IPR006394; KEGG: hor:Hore_15460 glutamate mutase
FT                   subunit S; PFAM: cobalamin B12-binding domain protein;
FT                   PRIAM: Methylaspartate mutase; SPTR: B8CYC6 Glutamate
FT                   mutase subunit S; TIGRFAM: methylaspartate mutase, S
FT                   subunit; PFAM: B12 binding domain; TIGRFAM: methylaspartate
FT                   mutase, S subunit; methylmalonyl-CoA mutase C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12023"
FT                   /db_xref="GOA:D9QUW4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR006394"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUW4"
FT                   /protein_id="ADL12023.1"
FT                   /translation="MEDKTIVMGVIGSDVHAVGNRILQEAFEKAGFEVINIGVLAPQED
FT                   FINAAVETDADAILVSSLYGHGEMDCKGFKEKCVEAGLEDIVLYVGGNLVVGKQDWEPV
FT                   KEKFLDMGFDRVYPPGTLPEEPIADLKEDLGIEE"
     atggaagata agacaatagt aatgggagtt ataggttcgg atgtacatgc agtaggcaat        60
     agaatcttac aggaagcatt tgagaaagcg ggatttgaag tgattaatat cggggtgtta       120
     gcacctcagg aagatttcat taatgctgca gtggagacag atgctgatgc tattttggtt       180
     tcttcactct acggccatgg agagatggac tgtaaaggct ttaaagagaa gtgtgtagag       240
     gcaggattag aggatattgt tctttatgtt ggcggtaact tagttgttgg aaaacaggac       300
     tgggaaccgg taaaagagaa attcttggat atgggctttg accgtgtcta cccaccagga       360
     acattaccag aagaaccgat tgctgattta aaagaagatt taggtattga agagtag          417
//

If you have problems or comments...

PBIL Back to PBIL home page