(data stored in SCRATCH zone)

EMBL: CP002105.PE55

CP002105.PE55        Location/Qualifiers
FT   CDS_pept        57172..57777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0055"
FT                   /product="Radical SAM domain protein"
FT                   /note="InterPro IPR007197; KEGG: drm:Dred_1747 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: A4J5B9 Radical SAM domain protein; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11607"
FT                   /db_xref="GOA:D9QSR9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR9"
FT                   /protein_id="ADL11607.1"
FT                   /translation="MDITYGLGDSLYLNLTNRCTNQCEFCVRQYKDGIAGYNLRLDKEP
FT                   TVKEVIAEIENPEDYEEIVFCGYGEPLIRLEAVIEIADWLQKFDVAVRINTNGQANLIH
FT                   QRNIVPELKGLIDTISISLNAKNAKKYKQLCNPEFGLDTFPAILDFIEECKGIIPNVVL
FT                   SVVKYPTTSIYECRKIAENLGVEFKVRQYSQSDTKEDN"
     atggatatta cctatggatt aggggattcc ctttacttga atttaactaa tcgctgtact        60
     aaccaatgtg aattctgtgt aagacagtat aaagatggaa ttgcaggcta taatctacgt       120
     ttggataaag aaccgacagt taaagaagtg attgctgaaa ttgagaatcc agaggattat       180
     gaggagatag tcttctgtgg ttatggagag cctttgattc gtttagaagc agtaatagaa       240
     atagctgatt ggctgcagaa gtttgatgta gcagtgagaa taaatactaa tggccaagca       300
     aatttgatcc accaacgtaa tatcgttccg gagttgaaag gcttaattga tactatttca       360
     attagcctta atgctaaaaa tgctaaaaag tataaacagt tatgtaatcc ggagtttgga       420
     cttgatacct ttccggcaat cttagatttt atagaagaat gtaaagggat aattcctaat       480
     gtagtcttaa gtgttgttaa gtatcctact actagtattt atgagtgtag aaagattgct       540
     gaaaaccttg gtgttgagtt taaagttaga caatacagtc agtctgatac aaaagaagat       600
     aattaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page