(data stored in ACNUC7421 zone)

EMBL: CP002116.PE1

CP002116.PE1         Location/Qualifiers
FT   CDS_pept        150..1565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR020591:IPR001957:IPR003593:IPR013159:IPR 013317;
FT                   KEGG: tde:TDE0001 chromosomal replication initiation
FT                   protein; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase;
FT                   SPTR: Chromosomal replication initiator protein dnaA;
FT                   TIGRFAM: chromosomal replication initiator protein DnaA;
FT                   PFAM: domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79161"
FT                   /db_xref="GOA:E1R6M9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6M9"
FT                   /protein_id="ADK79161.1"
FT                   /translation="MNTQSRWDFSIFWQEALNQLKNELSDQEFVMWFSNISYHSSEEGK
FT                   LILSVPSAFYRDQVKQRYTGIIKEKLYELSGFQLDVDFIVTKRATSESPKEKNEVSDTP
FT                   QPPMAVKPVPVSVSPAKNDPPKKHPDLRPDYTFENFVIGENNTLAANACMAISKNPGTA
FT                   YNPCLIYGGVGLGKTHLIQSIGNYAWAHNPDIKIAYVTAETFTNEFIEAIHHNKNHQFK
FT                   NKYRKVDILLIDDIHFLQEKTGTQEELFHTFNALYETNKQLVFTCDRPVSELKQLTDRL
FT                   RSRFERGLNVDLQAPAFETRFAILKQKVEEKKVPIDDEVIELICRNVTTNVRDLEAALT
FT                   RLIAYADLLHKKVTLDIARQQLKDVFSNPKMSNITVEMIQRVTAEYFNLSPNDLRGKKR
FT                   TKAIAFPRQIAMYITREITEFSTTEVGLEFGGRDHTTVMHACQRVESRMQTDPSLEPII
FT                   QRIVRQIKEYGTK"
     atgaatacac aaagcaggtg ggacttttcc atcttctggc aggaagcatt gaaccagttg        60
     aaaaacgaac tatcggacca ggagtttgtt atgtggttca gtaacatctc ctatcactcc       120
     tccgaagagg gaaagcttat cctttcggtt ccctcggcat tctaccgtga ccaggtaaaa       180
     cagcgttata ccggcataat aaaggaaaaa ctctacgaac tatccggttt tcaactggat       240
     gtcgatttta tcgttacaaa gcgagcaaca tcggaatcgc cgaaggagaa aaatgaagtt       300
     tctgataccc ctcagccccc catggcggta aaaccggtac ccgtatcggt ctcaccggct       360
     aagaatgatc ccccaaaaaa gcatcccgat cttagacccg attacacgtt cgagaatttc       420
     gttattggtg agaataacac ccttgcggca aacgcttgta tggccatcag taaaaatccg       480
     ggaactgcct ataatccctg tctgatatat gggggagtag gtcttggaaa aacgcatctc       540
     attcagtcaa tcggaaatta tgcatgggca cataatcccg acataaaaat tgcttatgtt       600
     acggcggaaa ccttcaccaa cgaatttata gaggcgattc accataacaa aaatcatcaa       660
     ttcaaaaata aatatagaaa ggtcgatatc ctgcttatcg acgatatcca ttttctccag       720
     gaaaaaacgg gaacacaaga agaactcttt cataccttca acgctttgta tgaaacaaac       780
     aagcagcttg tttttacctg tgaccgtccg gtgtcagagc tgaaacagct cactgatcgg       840
     ctgagaagcc ggtttgaacg tggactcaac gtcgaccttc aggccccagc ttttgaaaca       900
     aggtttgcca ttttaaagca gaaggtagaa gaaaaaaagg taccgataga cgatgaagtt       960
     atcgaactca tttgtcgaaa cgtcaccaca aatgtaagag atctcgaagc cgcactaaca      1020
     cgactgattg cctatgcaga tctcttgcat aagaaagtga ccctcgatat tgccaggcag      1080
     caactcaaag atgtcttttc caatcccaaa atgagtaata tcaccgttga aatgatacag      1140
     cgcgttactg ccgaatactt caatctctcc cctaacgacc ttcgtggtaa aaaaaggaca      1200
     aaagccattg cctttccccg acagatcgcc atgtatatta cccgggaaat aaccgaattc      1260
     agcaccacgg aagtcggtct ggaatttgga gggcgagacc ataccactgt tatgcatgca      1320
     tgccaacgag tggaaagcag aatgcaaacg gatcccagct tggaacctat catccaacgc      1380
     attgtacggc aaatcaaaga gtacgggaca aaataa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page