(data stored in ACNUC7421 zone)

EMBL: CP002116.PE10

CP002116.PE10        Location/Qualifiers
FT   CDS_pept        7607..8773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0010"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: tde:TDE2470 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79170"
FT                   /db_xref="GOA:E1R6N8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N8"
FT                   /protein_id="ADK79170.1"
FT                   /translation="MDTKRKVLFTSESVSEGHPDKVCDQISDAVLDACLREDSTSRVAC
FT                   ETFTTTGMVLVGGEISTSTYVNLQDVVRGVVKRIGYDRPEYGLDWESMAVIDTIHNQSS
FT                   DISMGVTAGENKYKSQGAGDQGMMFGFACNETEELMPAPIIFAHRLLQKAAAVRKSGEC
FT                   SWMRPDAKSQVTVQYEGGKPVRIDTIVISHQHSPSVSIKEIEASLRKRVIEPVLGDTGL
FT                   IDEKTRFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSA
FT                   AYMARYVAKNIVAAGLCDRCELELSYAIGVPFPISVMVDTFGTATVPEERIEAAVEKVF
FT                   DLSPEGIIRELGLLAPIYEATAAYGHFGRDGFSWERVDKTEELKKAVG"
     atggatacaa aaaggaaagt actttttact tcagagtctg tcagtgaggg acatcccgat        60
     aaggtatgtg atcaaatttc cgacgccgtt cttgatgcct gtttgcggga ggattccact       120
     tcgagggttg cctgtgagac ctttacaact acggggatgg ttcttgtcgg tggagagatc       180
     agtacctcta cctacgttaa tcttcaggat gtggttcgag gtgttgtgaa gcggataggg       240
     tacgatcggc cggagtatgg ccttgattgg gaatccatgg ctgttatcga tacaattcat       300
     aatcagagca gtgacatctc catgggcgtt accgcaggtg agaataagta taaatcccag       360
     ggagccgggg atcagggaat gatgttcggt tttgcctgca atgaaaccga agagcttatg       420
     ccagcaccca tcatctttgc ccaccgtctg ctgcaaaaag cggcagcagt acgaaagtcg       480
     ggggaatgtt cctggatgcg gccggatgca aagagtcagg ttaccgttca atacgaaggt       540
     ggaaagccgg tgcggatcga taccattgtc atcagccatc agcatagccc ttcggtttcg       600
     ataaaagaga tagaagcgag tctccgcaaa cgggtcatag aacctgttct cggcgatacg       660
     ggactgatag acgagaagac acggtttttc atcaatccga cgggacgctt tgtgatagga       720
     ggtcctcatg gtgattcggg acttaccggt agaaagatta ttgtcgatac ctacggcggt       780
     atggggcgtc acggcggagg ggctttcagt ggaaaggacc caagtaaagt agatcgttcg       840
     gccgcttaca tggcccgcta tgtggcgaaa aacattgttg cggcgggatt gtgcgatcga       900
     tgtgagttgg aactctctta tgccattggc gttcccttcc ccatttcggt tatggtggat       960
     accttcggaa cggctactgt gcccgaagag cggattgaag ctgcagttga gaaggttttt      1020
     gatctctctc ccgagggaat tatcagggaa ttgggtcttt tggcgcctat ctacgaagcg      1080
     acggcggcat acggtcactt tggaagagac ggtttttcct gggaacgggt agacaagacc      1140
     gaagagctga aaaaggccgt tggttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page