(data stored in ACNUC7421 zone)

EMBL: CP002116.PE100

CP002116.PE100       Location/Qualifiers
FT   CDS_pept        105282..106430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0100"
FT                   /product="thymidine kinase"
FT                   /note="COGs: COG1435 Thymidine kinase; KEGG: bdu:BDU_798
FT                   thymidine kinase; SPTR: Thymidine kinase; PFAM: Thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79260"
FT                   /db_xref="GOA:E1R8B6"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B6"
FT                   /protein_id="ADK79260.1"
FT                   /translation="MNEVKNNPETISFLKSLGFPSVRVHHSFNHFDFSRPDRRILVIGP
FT                   MGSGKTEYSARVWRDAQVALTKSETIARETSTDGADRRKVFFIRSLLDTQRFPDYPEDA
FT                   LAYRGGYERCGDYIARISDSFALEKLVHDMPEIGTWIVDEASFYDERLVYVVRNECQRR
FT                   GLIFIFPALILNFRRDIFNPTARLMLETATDVFPLTAYCEHPDCLEDSFYTYRYYQIDG
FT                   EECPALYFDPLIVIGGDRKKEDAVEPNYCTRCDRHHYLPGKEYTFFTLKPLGQQASGGN
FT                   SDPLKRELAALQERKGNSLLARHLRDKFGHDEEQRVNLNALKVARIAERALIYLYAEQN
FT                   LIPEELLLKLVNELGLDRVYMKKTLSENGRLVNLDQQILDGF"
     atgaacgaag tcaagaacaa tccggagacc atcagttttc tcaaaagcct cggatttccc        60
     agtgtgcggg tgcaccattc ctttaatcat ttcgatttta gccgtcccga tcggcgaatc       120
     cttgtcatcg ggcctatggg atcgggcaaa accgagtatt cggcgcgagt ctggcgcgat       180
     gctcaggttg ccctgacaaa aagcgaaact attgctcggg aaaccagtac cgacggggcc       240
     gatcgcagga aggttttttt tattcgttcg ttactggaca cccagcgatt tcccgattat       300
     ccggaggatg ctcttgccta tcggggtgga tatgagcgtt gcggcgatta catcgccagg       360
     ataagtgact cctttgccct tgaaaagctt gtacacgaca tgccggaaat cggtacctgg       420
     atcgttgatg aggccagttt ttacgatgag cggcttgtat acgttgtacg aaacgaatgc       480
     caacgtcgtg gacttatctt catctttcct gctttgatcc tgaatttcag gcgcgatatt       540
     ttcaatccca cggcccgact catgctcgaa accgccaccg atgtttttcc cttgaccgct       600
     tactgtgagc atcccgactg tcttgaggat tctttctata cctaccgcta ctaccaaata       660
     gatggagagg agtgtcccgc tctctatttt gatccgctca ttgtgattgg gggggatcga       720
     aaaaaagagg atgccgtgga accgaattat tgtacccgct gcgatcgcca ccattacctc       780
     cccggcaagg agtacacctt ttttaccttg aaacctctcg gtcaacaggc cagcggaggc       840
     aatagtgatc cgctgaaacg ggagcttgca gccttacagg agcgaaaagg gaattccctt       900
     ctcgctcgtc atctgcggga taaattcgga cacgatgagg aacaacgggt aaacctgaat       960
     gccctcaagg ttgcccgcat tgccgagcgt gcccttatct atctttatgc cgagcaaaac      1020
     ctgatccccg aagaattgct gttgaaactc gtaaatgaat tagggctgga ccgggtatac      1080
     atgaaaaaaa ccttatcgga aaatggccga ctcgttaatc tggatcaaca gatactcgac      1140
     ggtttttag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page