(data stored in ACNUC7421 zone)

EMBL: CP002116.PE101

CP002116.PE101       Location/Qualifiers
FT   CDS_pept        complement(106440..106844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0101"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312:IPR016131; KEGG: dsa:Desal_0057
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein; SPTR: Hemerythrin-like
FT                   metal-binding protein; TIGRFAM: hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain; TIGRFAM: hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79261"
FT                   /db_xref="GOA:E1R8B7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B7"
FT                   /protein_id="ADK79261.1"
FT                   /translation="MSLITWNSDYELGIPGIDAQHKKFVEILNTFYDQLAASDIESKTK
FT                   TLLDEVLDYTLYHFIEEERFMTKMGYEKLEEHKRLHEEIRGKIQAFRTSMDEGKLVMSM
FT                   KITSELKDWIKNHILIEDKKYAEKYLQTQQ"
     atgagtttaa taacatggaa ttcggactac gagcttggga tccccggcat cgatgcacaa        60
     cacaaaaaat ttgtagaaat tctcaatacg ttttatgatc agcttgccgc tagcgatatt       120
     gaaagcaaaa caaaaacctt gctggatgaa gttcttgatt atacactcta tcactttatc       180
     gaagaagaac ggtttatgac aaagatgggc tacgaaaaac ttgaagagca caaacggctt       240
     catgaggaga taagaggaaa gatccaggct tttcgtacat caatggatga ggggaaactg       300
     gtaatgtcaa tgaaaataac ctcggaactc aaagattgga ttaaaaacca tattttaatc       360
     gaagataaaa aatatgccga gaagtattta caaactcaac aatag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page