(data stored in ACNUC7421 zone)

EMBL: CP002116.PE102

CP002116.PE102       Location/Qualifiers
FT   CDS_pept        complement(106846..107262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0102"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312; KEGG: gem:GM21_3958 hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain protein; SPTR: Hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79262"
FT                   /db_xref="GOA:E1R8B8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B8"
FT                   /protein_id="ADK79262.1"
FT                   /translation="MGFMAWSSKFELGIPEMDEQHKKWLEILNSFYDHLSDKDLTTQMK
FT                   GLIQDVIDYTQYHFSEEEKLMASIGYHELNQQKQMHKEITDKIIRFKQRLDAGNLVIST
FT                   AVTSELKSWFKEHIMVEDKKYAEKYFQVTQKGGI"
     atgggattta tggcttggag ctcgaaattc gaactgggca tcccggagat ggatgagcaa        60
     cataaaaagt ggctcgagat tctgaatagt ttttatgacc atcttagcga caaagacctt       120
     actacccaaa tgaaaggcct cattcaggat gttatcgact atacacagta tcatttttcg       180
     gaagaagaaa agctcatggc aagtatcggt taccacgaac tgaatcagca aaagcagatg       240
     cataaagaga taacagataa aatcattcga ttcaaacagc gtttggatgc cggaaatttg       300
     gtgatatcaa cagccgtaac ctccgaactg aaatcatggt tcaaagaaca tatcatggtc       360
     gaagacaaaa aatatgccga gaagtatttt caggtaacac aaaaaggagg gatatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page