(data stored in ACNUC7421 zone)

EMBL: CP002116.PE103

CP002116.PE103       Location/Qualifiers
FT   CDS_pept        107373..108086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0103"
FT                   /product="DNA alkylation repair enzyme"
FT                   /note="COGs: COG4912 DNA alkylation repair protein;
FT                   InterPro IPR014825; KEGG: mma:MM_0566 hypothetical protein;
FT                   PFAM: DNA alkylation repair enzyme; SPTR: Putative
FT                   uncharacterized protein; PFAM: DNA alkylation repair
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79263"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B9"
FT                   /protein_id="ADK79263.1"
FT                   /translation="MEGNVVEFVRNELALHGDDSVRESGKRFFKEETKSYGVKTSVVTK
FT                   IAKSGFRELKGLDKNTILALCEELWKSGYMEESFIACHWAYALRETFIPDDFVIFEGWV
FT                   EHYVSNWASCDTLCNHTVGAFVEMYPEYIENLKRWAKSEGRWMRRAAAVSLIIPARSGL
FT                   FLEDIFEIADTLLLDQDDLVQKGYGWMLKAASQAHQREVYDYVMSKKAMMPRTSLRYAI
FT                   EKMPKELRVKAMAKQ"
     atggaaggga acgtggtcga atttgttcga aacgagctgg cgctgcacgg tgatgattct        60
     gttcgtgaaa gtggaaagcg ctttttcaag gaagaaacca agagctacgg cgtaaagacc       120
     tctgtggtaa caaagattgc gaaatccggt tttcgtgaac ttaaaggctt ggataagaat       180
     acaattctcg ccttatgcga agagctctgg aagtcggggt acatggaaga gagctttatt       240
     gcatgccatt gggcctacgc cttacgtgag acgttcatcc ccgatgattt tgtgattttc       300
     gaaggatggg tggagcacta tgtgagtaac tgggcctctt gcgataccct ctgtaaccat       360
     acggtgggtg cctttgtcga aatgtacccc gaatatatcg aaaacctgaa aaggtgggcg       420
     aaaagcgagg gtcgttggat gcgtcgggcc gctgcggtgt cgcttatcat ccctgcaagg       480
     tcgggacttt ttcttgaaga tatttttgag attgcggata cattgctgct tgatcaagat       540
     gacttggtgc agaaaggcta cggctggatg ctgaaggcgg caagtcaggc ccatcaacgg       600
     gaggtttatg attatgtcat gagcaagaaa gccatgatgc cgaggacctc cctgcgctat       660
     gccatcgaga aaatgccgaa agagctgcgt gtaaaggcaa tggcaaaaca atga             714
//

If you have problems or comments...

PBIL Back to PBIL home page