(data stored in ACNUC7421 zone)

EMBL: CP002116.PE104

CP002116.PE104       Location/Qualifiers
FT   CDS_pept        complement(108090..108626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0104"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="COGs: COG3797 conserved hypothetical protein;
FT                   InterPro IPR012545; KEGG: sna:Snas_5447 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1697; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1697)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79264"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C0"
FT                   /protein_id="ADK79264.1"
FT                   /translation="MNQYAAFLKGVNVGGKNRLSMAELREAMERHGFSAPKTYINSGNI
FT                   LFFHNAEKSEVKKELQDMIEQAFGLTIEVVVKTKEEINDTLQSDPFDTTTETEPAKKMV
FT                   MMLTSKVDPERFASIEADDKIIEKTYERGDLLYIYYRNGAGRSKLTIDYVEKVLGTSCT
FT                   ARNWNTLLKMKEILE"
     atgaatcaat atgcagcatt tctgaaggga gtaaacgtcg gagggaagaa ccgcctttcc        60
     atggccgaac tacgggaggc catggaaagg catggcttct cggcaccgaa aacctatatc       120
     aacagcggta atattctctt tttccataat gcagaaaaaa gcgaagtaaa aaaagagctg       180
     caagatatga tcgaacaggc tttcggtctg actatcgaag tggtggtaaa gacgaaagag       240
     gagatcaacg acacgctgca gagcgacccc tttgatacaa caaccgaaac agagcctgcc       300
     aaaaagatgg ttatgatgct gacaagtaag gtagacccgg aaagatttgc ttcgatagaa       360
     gcagatgaca aaatcatcga aaaaacctac gaaagaggag atcttcttta tatctattat       420
     agaaacggag caggcaggtc aaaactgacc atcgactatg tggaaaaagt cttagggacc       480
     agttgcaccg cacgtaattg gaataccctt ctcaaaatga aggaaatact ggaataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page