(data stored in ACNUC7421 zone)

EMBL: CP002116.PE105

CP002116.PE105       Location/Qualifiers
FT   CDS_pept        complement(108623..108964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0105"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896; KEGG: dhd:Dhaf_2058
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79265"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C1"
FT                   /protein_id="ADK79265.1"
FT                   /translation="MNSPRMLPNPPTPNEPIQFASDICNGCNLCVNICRSDVLMPHPEK
FT                   GKPPIVLYPDECWYCGTCVLECNRKGAIKLVHPMNQSVTVIWKRKATGENFRLGMKHPP
FT                   APNTRKPCS"
     atgaacagcc ctcgcatgct gcccaatccc ccaaccccaa atgagccgat ccagttcgcc        60
     tccgacattt gcaacggatg caacctctgc gtgaatatct gccgttcaga tgtcctgatg       120
     cctcatccgg aaaaaggcaa gccgcccatc gtactctatc ccgatgagtg ctggtattgc       180
     ggaacctgtg tgctcgaatg caacaggaaa ggagcaataa aacttgtcca tccgatgaat       240
     caaagcgtta ctgttatctg gaagcgaaag gccacaggag aaaattttcg tcttggcatg       300
     aagcatccac cggcccccaa cacaagaaag ccttgctcat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page