(data stored in ACNUC7421 zone)

EMBL: CP002116.PE106

CP002116.PE106       Location/Qualifiers
FT   CDS_pept        complement(108961..110961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0106"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   pen:PSEEN0175 putative oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: Predicted protein; PFAM: domain; FAD
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79266"
FT                   /db_xref="GOA:E1R8C2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C2"
FT                   /protein_id="ADK79266.1"
FT                   /translation="MSTWHEYLNEGNPVPLWPYPVNYGRENRLSTDVLIFGGGIAGSHA
FT                   AIGARKAGARVLVVEKEATKWSGNGGAGVDHWLSACTNPCSKITPEEYTKRVLIDCGGY
FT                   DCGPLRYISSRESWEALLDCESMGVKIRDTDEEFKGAAFRDEETGLLFAYDYENRCEIR
FT                   VWGHNIKPSLYKGMRKLGVEILDRVMITAFLVEGEGASRRVCGAMGIHTRTGEFYIIEA
FT                   KAVVLATGLPGRIWNFSTEYRSTFRDPNCTGEGVSAAWRAGAEFTRLEESFPDSGTLAY
FT                   ISYAVGNAHNTWHGCPIVDANGKEIPWVDRDDKELSSIEERFRPAQGQRFMLGDGLRVP
FT                   PSYENQNKKLAPDLPDRIRSGEFVLPLYADLSRMPEKERRAIFGLMVGNEGRTRIPVYE
FT                   TLTKAGFDPDKDMLAVPVMDPSAYCHSNFWAGVGAPQWRMWGCGGVVVDWDLRTNLEGL
FT                   YAAGGAVFGAGAHSGAAASGRFAGRRAADFASSAEEVPVDDEQIKREKKRVYAPLNPEG
FT                   HPIGWKELNAGIGRVMQDYCGQFKSEGGLSEGLRLIGEIRESEAASVSAANPHELIHAV
FT                   ECLAMLDVCEAVIHASLARKASSDYLCFNRIDYPRMDPPEWRKLIALRKGKEGAEIRDL
FT                   PFDYFLKDSNAPSLEENYLAHGGLSGKEAHK"
     atgagtacgt ggcatgaata tctaaacgaa gggaaccccg ttcctctctg gccctacccg        60
     gtaaactacg gccgagaaaa cagactctcc accgatgttc ttattttcgg tggaggaatt       120
     gcgggctctc atgcggcaat aggtgcccga aaggcgggag cccgggtttt agtcgttgag       180
     aaagaagcaa cgaaatggag cggaaacggg ggagcaggag tagaccattg gttatcggcc       240
     tgtacgaacc cctgttcgaa gattaccccg gaagaatata ccaagcgagt cctcatcgac       300
     tgtggaggct acgactgcgg acctttgcgc tatatctcgt ccagggaaag ctgggaggcc       360
     cttctcgatt gcgagtctat gggtgttaag atacgtgata cagatgagga atttaaaggc       420
     gctgcttttc gcgatgaaga aacagggctc ttgttcgcct atgattacga aaaccgctgc       480
     gaaattcgcg tctgggggca taacataaag ccctcccttt acaaagggat gcgcaagctt       540
     ggcgttgaaa tcctggatcg ggtgatgatt accgctttcc ttgttgaggg tgaaggtgcg       600
     tcccgcaggg tctgcggagc catgggaatc cacacccgca ccggcgagtt ctatatcatc       660
     gaagcaaagg ccgttgttct ggccacgggg cttcccggtc gtatctggaa cttttccacg       720
     gaatatcgat ccacttttcg cgacccgaac tgtacgggag aaggggtttc cgccgcatgg       780
     cgggccgggg ccgagttcac ccgattggaa gagtccttcc ccgattccgg aacccttgcc       840
     tacatctctt atgcggtagg aaatgcccat aacacctggc acggctgccc cattgtggat       900
     gcaaacggta aggaaattcc ctgggtagac cgggatgata aggagctctc ttctatcgag       960
     gaacggtttc gtcccgcaca gggacagcgc ttcatgctgg gcgacgggtt acgggttcct      1020
     cccagttacg aaaaccaaaa caaaaaactc gccccggatc ttcccgatag gattcgcagc      1080
     ggagagttcg tactccccct ctacgcagac ctttcccgta tgccggaaaa agagcgaaga      1140
     gctatcttcg gccttatggt cggcaacgaa ggaaggacgc gcataccggt ttatgaaacc      1200
     ctaacgaaag caggtttcga ccccgacaag gacatgctcg cggtaccggt catggaccca      1260
     tcagcctatt gtcattccaa tttctgggca ggggtgggag caccccaatg gcgcatgtgg      1320
     ggttgtggcg gcgtggtggt cgactgggac ctgaggacca acctggaagg gctctatgct      1380
     gcaggagggg ccgtatttgg ggccggtgcc cattccggag ccgctgcaag cggccggttt      1440
     gccggacgca gggccgccga ttttgcatca tcggccgagg aagtcccggt ggacgacgag      1500
     cagatcaaac gggaaaaaaa gcgtgtctac gcccctctca accccgaggg gcaccccatc      1560
     ggctggaaag aactgaacgc cggcatagga cgggtgatgc aggactactg cggccagttc      1620
     aagagcgagg gggggctttc cgaaggcctg agactcatcg gagaaatccg agagtccgaa      1680
     gcagcctcag tttccgctgc caatccccat gagcttatcc atgccgtcga gtgtcttgcc      1740
     atgctcgatg tctgcgaggc tgttatccac gccagcctgg cacgtaaggc ttccagcgat      1800
     tacctctgct tcaaccggat cgattatcct aggatggacc ctcccgaatg gagaaagctc      1860
     atagcccttc gcaaaggcaa ggaaggggca gaaatccgtg atttgccctt cgattatttt      1920
     ctaaaggatt ccaatgctcc cagtttggaa gaaaactacc tggcccacgg cggcctttca      1980
     ggaaaggagg cacacaaatg a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page