(data stored in ACNUC7421 zone)

EMBL: CP002116.PE107

CP002116.PE107       Location/Qualifiers
FT   CDS_pept        complement(111582..112223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2494 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79267"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C3"
FT                   /protein_id="ADK79267.1"
FT                   /translation="MYRFEPIPGIFYGRFDRMVTYPAVLSMVHQYEESKESKEIEKLCL
FT                   TDEGYQPFRIYDFDGDFSILKNPLKIFFKTLWDGVLHLSIIRKRIGSLDDYYDDFVRTN
FT                   TKDMCPYCGLYLIDEVDVKTWEAFDHYVLKRIYPFLSVDFKNLASMCNKCNSGNKGNKD
FT                   PLHDSSNNRKKAFYLFKEDYGQIEIKVTLAHGDYENLFLRLVMRKVCLDR"
     atgtaccgtt tcgaacccat tcctggaatc ttctatggca ggtttgatag gatggttacc        60
     tatccggcag ttctttccat ggtgcaccag tacgaagaat ccaaagaatc gaaggagata       120
     gaaaagctgt gtttgactga tgaaggctat caaccatttc ggatttatga ctttgatggt       180
     gatttttcta ttctaaaaaa tcctctcaag atttttttta aaactctatg ggacggagta       240
     ttacacttgt cgataattcg gaaaaggata gggtctttag acgattacta tgatgatttt       300
     gtaagaacga atacaaagga tatgtgtcct tactgcggat tatatcttat tgatgaagta       360
     gatgtaaaaa catgggaggc ctttgatcac tatgtactta agcgtattta tccatttctt       420
     tctgtagatt tcaagaatct ggcttcgatg tgcaacaaat gtaatagtgg aaacaagggg       480
     aataaagatc ctctgcatga ttcaagtaac aacagaaaaa aagcctttta tctttttaag       540
     gaagattacg gtcaaattga aataaaagta acgcttgctc atggagacta cgaaaacctt       600
     ttcttgaggc ttgtgatgag aaaggtatgc ttggatagat ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page