(data stored in ACNUC7421 zone)

EMBL: CP002116.PE109

CP002116.PE109       Location/Qualifiers
FT   CDS_pept        complement(114950..116146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0111"
FT                   /product="carbamoyltransferase YgeW"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterProIPR006130:IPR002082:IPR017702:IPR006132:IPR 006131;
FT                   KEGG: efa:EF2577 aspartate/ornithine carbamoyltransferase
FT                   family protein; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; SPTR: Aspartate/ornithine carbamoyltransferase
FT                   family protein; TIGRFAM: carbamoyltransferase YgeW; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: probable
FT                   carbamoyltransferase YgeW"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79269"
FT                   /db_xref="GOA:E1R8C5"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C5"
FT                   /protein_id="ADK79269.1"
FT                   /translation="MDRIGIKEKIKSLSRLRTEDMYLNDFFHTWKKSDQEIKAVFEVAD
FT                   ILRGMRNNNISTRLFDSGLGISLFRDNSTRTRFSYASACNMLGLEVQDLDEGKSQVAHG
FT                   ETVRETANMISFMADVIGIRDDMYIGKGHTYMKEVAASVQAGYDAGILEQRPTLVNLQC
FT                   DIDHPTQSMADALHLINHFGGIENLKGKKIAMTWAYSPSYGKPLSVPQGIMGLMSRFGM
FT                   AVTLAHPEGYEVMPEVEKIAEINSAKSGGTFSKTNSMAEAFKDADIVYPKSWAPFKAME
FT                   KRTGLYGKGDFDGIDKLEKELLGQNADHKDWECTEELMNSTKEGKALYMHCLPADITDV
FT                   SCEKGEVAASVFDRYRDPLYKQASFKPYIIAAMIFLSKVKNPADRLDTILNANLPRIV"
     atggacagaa ttggaattaa agaaaaaata aagtcgctgt caagactcag aacagaagat        60
     atgtacctga atgatttctt tcacacctgg aaaaaaagtg accaggagat aaaggctgtt       120
     tttgaagttg cagatatcct gagaggaatg cgaaataaca atatctccac caggcttttc       180
     gacagcggtc ttggaataag cctatttaga gacaattcca caagaacaag attcagctac       240
     gcttcggcat gcaatatgct tggacttgaa gttcaggatc tggatgaagg aaaaagccag       300
     gttgcccatg gcgagactgt aagggaaaca gccaatatga taagtttcat ggccgatgtc       360
     atcggtataa gagatgatat gtacatcggt aagggacaca cctatatgaa ggaagtcgca       420
     gccagcgtac aggctggata cgatgcggga attctggaac aacgccccac ccttgttaac       480
     ctccagtgcg atatagatca cccaacccag tcaatggccg acgcccttca ccttatcaat       540
     cacttcggag gaatagaaaa tcttaaaggc aaaaagatag ccatgacatg ggcttattca       600
     ccatcctatg ggaaaccact ctctgtaccc cagggaatca tgggcctcat gagccggttc       660
     ggaatggccg tcaccctcgc gcacccggaa ggttatgagg taatgcctga agtggaaaaa       720
     atcgcagaaa taaattccgc gaaatcaggt ggtacttttt ccaagacaaa ctccatggcc       780
     gaagcgttca aagacgcgga cattgtttat cccaaaagct gggcaccgtt caaagccatg       840
     gaaaaaagga ctggtctcta cggaaaggga gattttgacg gaatcgacaa gctcgaaaag       900
     gaacttcttg gtcagaacgc agatcataag gactgggaat gtaccgaaga actcatgaat       960
     tcaacaaaag aaggaaaagc cctttacatg cactgtctgc cggccgacat cactgatgta      1020
     tcatgtgaaa agggagaagt tgcagcttca gtttttgacc gctaccgtga ccctctttac      1080
     aagcaggcca gcttcaaacc ctacattatt gccgccatga ttttcctgag taaggtcaaa      1140
     aatcccgccg accggctgga cacaatactg aatgcaaacc tgcccagaat agtgtag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page