(data stored in ACNUC7421 zone)

EMBL: CP002116.PE11

CP002116.PE11        Location/Qualifiers
FT   CDS_pept        8785..9717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0011"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: vvy:VV1444 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: Membrane protein of unknown
FT                   function (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79171"
FT                   /db_xref="GOA:E1R6N9"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N9"
FT                   /protein_id="ADK79171.1"
FT                   /translation="MEGIVSLLILLAFLGGGMMCAKSTFAPKPKGVTCIIAVILRILLL
FT                   FMGIRIGRLGMNIREVQTIGLLGLVFGSATIFGTVLFLIILNGLSGGNESKHKRGRSES
FT                   RRPSAKRLLWESLGLFAFVIVGIVAGKILPFASLIPNEAGTWTLYCLLFFIGMQMMQSD
FT                   IKFVSLLRDRRMLLLPLVTALGSICGGIMVSPLFHLSVGEAAALSAGFGWYSLSGVLIS
FT                   DLGNPLLGSAAFLVNLVRESLALFMIPLLGGLGLPHLAIGVGGATSMDVTLPLVETSCG
FT                   AGYVPLSIAHGALLSLLVPFLVPFFWGFA"
     atggaaggaa ttgtttctct cctgattctc ctggcctttc ttggtggggg aatgatgtgc        60
     gccaagagca cattcgcgcc caagcccaaa ggggtcacgt gtataattgc cgttatactc       120
     cgcatcttac tgcttttcat gggcatcaga atcggccgcc tcggtatgaa tatccgggaa       180
     gtacaaacca ttggccttct tggcttggta tttgggagtg caacgatttt cggaacggtc       240
     ttgtttctta tcattctgaa cggactgtcg ggaggaaacg agtcgaagca taaaagagga       300
     cgttccgagt cacgacgtcc ttctgctaaa aggcttcttt gggaatctct tggattgttt       360
     gcttttgtta ttgtcggcat tgtggcagga aagattcttc cttttgcttc cctcatcccg       420
     aatgaagccg gaacctggac gctttattgt ttgctctttt tcatcgggat gcagatgatg       480
     caaagcgata taaagtttgt ctctctgctt cgggaccgaa gaatgcttct attgcctctt       540
     gttacggcat taggatcgat ttgcggtggg atcatggtct ctcccctctt tcacctctca       600
     gtgggagaag ctgcggctct ctcggccggc tttggttggt acagtttatc gggggtgctt       660
     atctcggatc tcggaaatcc gttactcggt tccgccgcat ttcttgtcaa tcttgtaaga       720
     gagagccttg ctcttttcat gatacccctt ttgggaggct tgggccttcc tcatcttgct       780
     atcggcgtcg gaggggccac ttcaatggac gtcacccttc cccttgtgga aaccagctgc       840
     ggggcagggt atgttcctct ttctattgcc cacggggcac ttctttcgct tcttgtcccc       900
     tttctcgttc cttttttttg ggggtttgcc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page