(data stored in ACNUC7421 zone)

EMBL: CP002116.PE110

CP002116.PE110       Location/Qualifiers
FT   CDS_pept        complement(116187..117647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0112"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro IPR001926;
FT                   KEGG: pmo:Pmob_1727 pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79270"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C6"
FT                   /protein_id="ADK79270.1"
FT                   /translation="MIDLTTNEEQIQKNAIRCKEQGILFPTFAEMREPETISEDIKKKL
FT                   KDVGLWDVNSLNLYRVNWQNEPKKFGGGFGDVNYMELPSSLTGTRARILALVGKWFPTG
FT                   AHKVGASYSCLAPRLVTGQFNPMKEKAVWPSTGNYCRGGAYISRLLACDSIAILPEEMS
FT                   QERFDWLKNIAGETIATPGCESNVKEIFDKCRELTESRGDTIEIFNQFDQFPNHLWHYE
FT                   VTGHSMEKVLKKAMGEDSRFAGTCLSSGSSGTLGSGEYLKTLYPKAKLSVAEALQCPTL
FT                   YNNGFGGHRIEGIGDKHVPWIHNLKNTDMVIAIDDEQTIRLLRLFNEPVGREYLKENGV
FT                   PAELLDQLDLLGISSIGNLIGTIKMAKYYELTEEDVLMTIFTDSFEMYESRLKELEEAR
FT                   GAYTREDAIRDYELINQVTFDHTMELSYQEQKRIHNLKYYTWVEQQDKTYDEINAQWYD
FT                   HDYWTNLYKVTPKLDELIIDFNRRIKAL"
     atgattgatc ttacaaccaa cgaagaacaa attcaaaaga acgccatacg ctgcaaggaa        60
     caggggattc tttttcctac tttcgccgag atgagagagc cggaaactat ttccgaagat       120
     atcaagaaaa aactcaaaga tgtcggacta tgggatgtta actccctcaa cctttacagg       180
     gtgaactggc agaatgaacc taagaagttc ggcggaggtt tcggagatgt gaactatatg       240
     gaactcccct catctctgac aggtacaaga gccagaattc tggctcttgt cggaaaatgg       300
     ttccctacag gagcccacaa ggtaggggca agctacagtt gccttgctcc ccgtcttgtt       360
     acaggccagt tcaatcccat gaaggaaaaa gcagtctggc cctcaacggg aaattactgc       420
     cggggcgggg cctacatttc cagactccta gcctgcgatt caatagcaat tctccccgaa       480
     gagatgagcc aggagaggtt cgactggctc aagaatattg caggagagac catagcgact       540
     cccggctgtg aatcaaacgt aaaagaaatt ttcgacaaat gccgagagct gactgaaagc       600
     aggggtgaca caatcgagat cttcaatcag tttgatcagt ttcccaacca cctttggcat       660
     tatgaggtca caggtcactc catggaaaaa gtcctgaaaa aagctatggg agaagacagc       720
     cgctttgcag gcacatgcct ctcatccggt tcatcaggaa ctctcggatc cggtgaatat       780
     cttaaaaccc tctacccaaa ggcaaaacta tcggtggctg aagcccttca gtgccctact       840
     ctttacaaca acggattcgg aggacataga atcgaaggaa taggagataa gcacgttcca       900
     tggattcaca acctgaagaa tactgatatg gtaattgcca ttgatgatga acagaccata       960
     cggctcttga gactttttaa tgaacccgtt ggaagagagt atctaaaaga gaatggggtt      1020
     ccggcagagc tcctcgatca gcttgacctt cttggaattt caagcatagg aaaccttata      1080
     ggtactatca aaatggctaa atattacgaa ttaaccgaag aagacgtact gatgaccatc      1140
     ttcacagatt cgttcgagat gtacgaaagc cgactaaagg aacttgaaga ggcccgcggt      1200
     gcttacacaa gagaagacgc gattcgggac tacgaactga ttaatcaggt tacctttgat      1260
     cacacaatgg aactttccta ccaggaacag aaacggattc acaacctcaa gtactacaca      1320
     tgggtcgaac agcaggataa aacctatgat gaaatcaatg ctcaatggta cgaccacgac      1380
     tactggacaa acctttataa agtaactcca aaactggacg aattaataat agatttcaac      1440
     aggcgaataa aagcactata g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page