(data stored in ACNUC7421 zone)

EMBL: CP002116.PE111

CP002116.PE111       Location/Qualifiers
FT   CDS_pept        complement(117651..118865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0113"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: kol:Kole_2070 M20/DapE family protein YgeY; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Peptidase; PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM: putative selenium metabolism
FT                   hydrolase; M20/DapE family protein YgeY"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79271"
FT                   /db_xref="GOA:E1R8C7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C7"
FT                   /protein_id="ADK79271.1"
FT                   /translation="MKQEILRKAEEYRDYVAQTLSEMVKIPSYSGKEEAICKRIKEICE
FT                   DAGFDEVRTDKLGSVIARIGNGPKSIAFDAHIDTVEIGDPDQWEKEPFSGLIADGLVHG
FT                   RGSSDQKGGAASMITAGRILKDINYNGQFTIYFTFTVMEEDCDGMCWKYLIEEEKLKPD
FT                   FYVSTEPTSTRIYRGHRGRMEMMVRLKGISAHGSAPERGESAAYKAARAALAMEKLNKD
FT                   LQPDEDNFLGKGTIVVSQIDVKGPSQCAVPDQAMLYLDRRLTWGEDADLAIGQVKEYIG
FT                   KALDCPPEEIDVTMPEYTKRGYRDYDYSQELYFPTWKMDADHPLVESGVDAYKTLWGKD
FT                   PVVDKWTFSTNAVATTGRHKIPAIGFGPGDESQAHAPNEINRIEDLVICAAFYAMLPYS
FT                   LEKRI"
     atgaaacagg aaattttaag gaaagcggaa gagtaccgcg actacgtcgc tcagaccctt        60
     tcggaaatgg ttaaaatccc ctcatatagt ggaaaggaag aggctatctg taaaaggata       120
     aaagagattt gtgaagatgc cggatttgat gaagtcagga cagataaact aggttctgtg       180
     atagcccgga ttggaaacgg cccaaaatca atcgctttcg acgcccatat tgatacagta       240
     gaaatcggtg atccggatca gtgggaaaaa gaacctttct ccggattgat tgccgatgga       300
     ctggtacacg gaagaggctc ctcggaccag aaaggaggag ctgcctccat gataaccgcc       360
     ggaagaatcc tcaaagatat aaactacaat ggccagttta ctatctattt cacctttaca       420
     gtcatggaag aagattgtga cggcatgtgt tggaaatatc tgattgaaga agagaagctg       480
     aaaccagact tctatgtatc aaccgaaccg acctctaccc gaatctacag gggccacagg       540
     ggacgcatgg agatgatggt acggcttaaa ggaatctcgg ctcatggttc agctcccgaa       600
     agaggcgaat cagctgcata caaggccgcc agggcagccc ttgcaatgga aaagctcaac       660
     aaggatctcc agccggatga agacaacttc ctgggaaagg gaacgatagt tgtttcacag       720
     atagatgtaa agggacccag tcagtgtgct gttcccgatc aagccatgct ttatctggac       780
     cgccggctta cctggggtga ggacgcagat ctggccattg gtcaggtaaa ggagtacata       840
     gggaaggcat tggactgccc tcctgaggaa attgacgtta caatgcctga atacacaaag       900
     agaggataca gggactatga ttatagccag gaactctact ttcctacatg gaaaatggat       960
     gctgatcatc ctcttgttga aagcggagta gacgcttaca aaacactctg gggaaaggat      1020
     ccggtagtgg acaagtggac attttccacc aacgcagttg cgacaaccgg caggcacaag      1080
     ataccggcaa tagggttcgg cccgggtgat gaaagtcagg cccacgctcc aaacgaaatc      1140
     aacagaatcg aagatcttgt tatctgtgca gctttctacg cgatgctgcc atacagcctg      1200
     gaaaaaagga tataa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page