(data stored in ACNUC7421 zone)

EMBL: CP002116.PE112

CP002116.PE112       Location/Qualifiers
FT   CDS_pept        119253..119996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0114"
FT                   /product="Hydantoin racemase"
FT                   /note="COGs: COG4126 Hydantoin racemase; InterPro
FT                   IPR015942; KEGG: rpf:Rpic12D_1297 Asp/Glu/hydantoin
FT                   racemase; PFAM: Asp/Glu/hydantoin racemase; PRIAM:
FT                   Hydantoin racemase; SPTR: Putative uncharacterized protein;
FT                   PFAM: Asp/Glu/Hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C8"
FT                   /protein_id="ADK79272.1"
FT                   /translation="MRCLIVNPNTSVHMTSSINHTMEELDKGDVSFDVISAEIGPESLE
FT                   SFYEYNLAASGVAYTLKKMDMQIYDGVLLACFGDPGLYGLKESLSCPVVGIAEASLSMS
FT                   LLLGYKFAIIVSLQKAVPMMINMVHQYGLGQRMAGVFPLNMPVLDLEKDKVSVIEKIRQ
FT                   VSRKAIIQGAETLILGCAGMTGIAKEVEKEMKVPVIDPVSAGFHSLKAIIESKLTTARH
FT                   GLYEPVPAKRIIGAEGRDSKYFGYF"
     atgcggtgtc taattgtaaa tccaaacacc agtgtgcata tgacatcgtc aataaaccat        60
     acaatggagg agttagataa aggagatgtt tcctttgacg taatcagtgc tgaaattggt       120
     ccagaatcat tggaatcttt ttatgagtac aatcttgcgg cctctggggt tgcctacacg       180
     ctaaaaaaga tggacatgca aatatatgat ggtgtgcttt tagcctgttt tggtgatccg       240
     ggattgtatg gactaaagga atctttgtcc tgtccagtgg taggtattgc tgaggcttct       300
     ctgtcaatgt cgctgttgtt gggttacaaa tttgcaatta tagtttctct gcagaaagct       360
     gttccaatga tgataaatat ggttcatcag tatggacttg gccagcgtat ggccggtgtt       420
     tttcctttga atatgccagt tctggatctt gagaaagata aagtttccgt tattgaaaaa       480
     attcgacagg tgagcagaaa agctattatt caaggcgcgg aaactcttat cctcggttgt       540
     gcaggtatga ctggcatcgc gaaggaagtt gaaaaagaga tgaaggttcc ggttattgat       600
     cctgtttctg ctggattcca tagcctcaag gcaatcatcg aatcgaaact cacgactgca       660
     cgtcatggtc tttacgaacc ggtgcccgcg aaaaggataa ttggagcgga gggtcgggac       720
     tctaaatatt ttggttattt ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page