(data stored in ACNUC7421 zone)

EMBL: CP002116.PE114

CP002116.PE114       Location/Qualifiers
FT   CDS_pept        121640..122818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0116"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: mta:Moth_0710 peptidase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; SPTR: Peptidase M20;
FT                   PFAM: Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: putative selenium metabolism hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79274"
FT                   /db_xref="GOA:E1R8D0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D0"
FT                   /protein_id="ADK79274.1"
FT                   /translation="MKLNSSQQKEVLAFARQLVCEPGNSGDEEKSALLIEKKMNELGYN
FT                   QVRVDPYGSVIGIINGSKPGPTILFDGHVDVVPIHEPDEWHHDPYGGEVVGDKLISRGS
FT                   ADMKGSVTAMIFAASYLDKEKLLGTIIVSASVAEELIPGRALEKILDEYKVDAVVVGEP
FT                   TKLRLGFTEKGRCSISMTVTGEVAHSSSPELGKNAIYIANDAIRRIREIPVNSDPFLGD
FT                   EVRELVELRSEPTPGYGSVPYYCWGLWECRILPGESEQALLNKFVSSQKGSEWEERIHF
FT                   QFETIDIPNFTGTHLIGKDFLPAWREDKNSGLYKQMEAAVEKSGIPVEYEPIYYGSNAL
FT                   MSCGVKKLPTVIFGPGDVALAHKPDEYLRIQDLWKATKIFNHIMELNGKYTY"
     atgaaactca atagtagtca gcaaaaagag gtccttgcat ttgccaggca gctggtatgt        60
     gaaccgggaa attctggcga tgaagaaaaa agtgccttat taatagaaaa gaaaatgaac       120
     gaattgggtt acaatcaggt tcgggttgat ccttatggaa gtgttatcgg tattatcaac       180
     ggttcaaaac cggggccgac aatcctgttt gatgggcatg tggatgttgt cccgattcat       240
     gaaccggatg aatggcatca cgatccgtat ggtggcgagg ttgttggaga caaacttatc       300
     agcagaggat ccgctgatat gaagggatct gtaaccgcaa tgatctttgc agcttcttat       360
     cttgataaag aaaaactcct tggaacaatc attgtttctg ccagtgtagc tgaagaattg       420
     atacccggcc gggcacttga gaaaattctg gacgaatata aagttgatgc ggttgttgtt       480
     ggagaaccga ccaaactgcg gcttggattt acggaaaagg gtagatgctc aataagcatg       540
     accgtaaccg gagaagttgc acacagcagc agtcctgaat tgggaaagaa tgccatatat       600
     attgcaaacg atgcaatcag gcgtattaga gaaattcctg taaactctga tccttttctg       660
     ggtgatgaag tcagggaact tgtcgagtta cgttctgagc ctactcctgg atatggcagt       720
     gtgccttatt attgctgggg actctgggag tgtcgaattc tacccggaga gagcgaacag       780
     gctctattaa ataaatttgt cagttctcaa aagggctcag aatgggaaga acggattcac       840
     tttcagtttg aaacgattga tatccctaat tttacaggta ctcatctgat cggtaaagac       900
     ttccttcccg catggagaga agacaaaaac agtggtttat ataaacagat ggaagctgct       960
     gttgagaaaa gcggaatacc tgtggaatac gagccgattt attatgggag caatgctctg      1020
     atgagctgtg gagtgaagaa attacctaca gttatatttg gtcctgggga tgtggctctt      1080
     gcgcacaagc ctgatgaata cctaagaatt caggacctct ggaaggcaac gaagatcttt      1140
     aatcatataa tggagctgaa tggaaagtat acttattag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page