(data stored in ACNUC7421 zone)

EMBL: CP002116.PE116

CP002116.PE116       Location/Qualifiers
FT   CDS_pept        122995..123981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0118"
FT                   /product="basic membrane lipoprotein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: ter:Tery_3674 basic membrane lipoprotein;
FT                   PFAM: basic membrane lipoprotein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79276"
FT                   /db_xref="GOA:E1R8D2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D2"
FT                   /protein_id="ADK79276.1"
FT                   /translation="MKNLKLAVVLVLLSVLVFGGCQGSSDDKDAGTKSAESKLKVAMVL
FT                   PGLKTDEAFNQFTYEGMMRAAEDLDIETAFVEEVKQDEQIEVIRQFAQQGYDIIIGQGG
FT                   QFGEALQTVAKEYPDQEFVFSVATDTGGVPNLTAVTVSYSHAGYIAGIMAGQMTKNNKV
FT                   AMILGEWYTPHRQMWESFQKGVAASGKDVEVKSVATGSWSDVNKAREASLALIADGVDV
FT                   LLPVLDAAYVGVLSAAQDSDDVLVVGSVLDMAKVAPEVVVGSVVYNWNELGYQEATGEI
FT                   TDGGTHILGIKENGITPVLNDLLSDEGKTAVEDAIAGLKAGNIDILP"
     atgaagaatc ttaaactggc agtcgttttg gtgcttttat cggtcctcgt ctttggaggg        60
     tgtcaaggct cttcagatga taaggacgcc ggtactaaat cagcggaatc aaagctcaag       120
     gtcgcaatgg tcttgcccgg attgaaaaca gatgaagctt tcaatcagtt tacctatgaa       180
     ggtatgatga gagccgcaga agatttggat attgaaactg catttgtgga agaagtaaaa       240
     caggatgagc agattgaagt tatccgacaa ttcgcacagc aggggtatga catcattatc       300
     ggtcagggtg gtcagtttgg tgaagccctc cagacagttg ccaaagaata tcctgatcag       360
     gagttcgttt tcagtgttgc aacagatacg ggaggagttc ccaatctgac agctgtaact       420
     gtcagttaca gccatgccgg atatattgca ggtataatgg ccggtcaaat gaccaagaac       480
     aataaagtag caatgatact tggcgagtgg tatactccgc atagacagat gtgggaaagt       540
     tttcagaaag gtgttgccgc aagcggtaag gatgttgaag taaagtctgt tgcaacagga       600
     tcatggtctg atgtcaataa ggcccgtgaa gcctcattgg ctctgatagc tgatggtgta       660
     gatgtcctct tgcctgttct tgatgccgcg tatgttggcg tattgagtgc agcacaggat       720
     tccgacgatg ttttggttgt cggtagcgta ttggatatgg ctaaagttgc tcccgaggtt       780
     gttgtcggca gtgttgtata taactggaat gagcttggat atcaggaagc taccggagag       840
     ataacggacg gaggtaccca tatccttggt attaaggaaa atggtattac acccgtatta       900
     aacgatttac tttcggatga aggtaagacg gccgtagaag atgcaatagc cggtttaaaa       960
     gctggaaata ttgatatctt accataa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page