(data stored in ACNUC7421 zone)

EMBL: CP002116.PE117

CP002116.PE117       Location/Qualifiers
FT   CDS_pept        124082..125605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0119"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: ctc:CTC00370 sugar
FT                   transport ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Putative uncharacterized
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79277"
FT                   /db_xref="GOA:E1R8D3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D3"
FT                   /protein_id="ADK79277.1"
FT                   /translation="MAQDGAFALRMEGISKFFPGVIANDRINLDCRRGEVLGILGENGA
FT                   GKTTLMNILYGLHQPDEGQIFLDGKQVTIDSPSKAIDLGVGMVHQHFMLVEALSALENV
FT                   ILGMPSKRITLDIESARKRLETLCEDYELHVDPSVEVWKMPVGKQQWLEILKALYRDIN
FT                   LLVLDEPSSVLTPSEGKQLFKAIRKITAEGRSVIFISHKLDEVLEVTDRITVIRDGRVV
FT                   GTVETKDASQEELTRMMVGRPVTITRKPRPVVTKDSPVLVMENVNADDDRGLPALKNFN
FT                   LTVRAGEIVGVAGVDGNGQRELAECIVGMRKYTSGSVQIQDRLIDRIIADTSFVGYIPE
FT                   DRQKTGLCLDMTVAENLIFKEVDNPPYLKNGILRLNSIKEHAQNMIQKYDIRTRSGDDL
FT                   VGNLSGGNQQKVIFAREINNEPVLVIASQATRGLDLGAVENVHNVLLNERNRGAAVLFI
FT                   STELQEVMSLSDRIIVMFRGELMGDVAGEGTDVSTIGRMMLGETLELDK"
     atggcacaag acggtgcgtt tgcattgcgc atggaaggaa tttctaaatt ttttcctgga        60
     gtgatagcca atgatagaat aaatctcgat tgtcgtaggg gtgaggttct tggaattctt       120
     ggagagaatg gcgcaggcaa aacaacctta atgaatattc tatatggact tcaccagccg       180
     gatgaaggtc agatatttct tgatggaaaa caagtaacca ttgattctcc ttctaaagca       240
     attgacttgg gagtcggaat ggttcatcaa catttcatgt tggtggaagc tctgtccgca       300
     ttagaaaatg tgatactcgg catgccttcc aaaaggataa ccctggatat agagtctgcc       360
     cgtaagcgtc tggagactct atgtgaggat tatgaacttc atgtagatcc ctctgtggaa       420
     gtgtggaaaa tgccggtggg taagcagcag tggctagaaa tcctgaaagc attatataga       480
     gatatcaatt tgctggtact cgacgaaccg agttctgttt taactccttc tgaaggaaag       540
     cagcttttca aggcgatacg taaaataaca gcagagggcc gctcggtaat cttcatcagc       600
     cataaattgg atgaagttct ggaggtcact gatcgtatca cagtcattcg ggatggtcgt       660
     gtagttggta cggttgagac aaaggatgca agtcaggaag aactgactcg tatgatggtt       720
     ggtcgtcccg tgacaattac aaggaaaccc agacctgtcg tgacgaagga tagtcctgtt       780
     ctcgtaatgg agaatgtaaa tgctgatgat gaccgtggtc tacctgcctt aaaaaacttt       840
     aacctgacag tccgtgctgg tgaaattgtc ggcgttgccg gagttgacgg taatggtcag       900
     cgggaattgg ctgaatgtat tgtaggaatg cgtaagtata cgagtggttc ggttcaaatc       960
     caggaccgcc tcattgatcg gatcatagct gatacttcat ttgtcggata tatacctgaa      1020
     gacagacaga aaaccggtct ttgtcttgat atgacagtgg cggaaaatct tatctttaag      1080
     gaagtagata accctccata cttgaaaaat ggtattcttc gcttaaattc aattaaagaa      1140
     catgcacaga atatgattca gaaatatgac atacggacac gatccggcga cgacctcgta      1200
     gggaatctct cgggagggaa tcagcagaaa gtcattttcg caagggaaat taacaacgaa      1260
     ccggttttgg taattgcatc tcaggcaacc agaggtttag accttggtgc ggtggaaaat      1320
     gttcataatg tgctgcttaa tgaacgtaat cgcggtgctg cagtattatt catttctacg      1380
     gaacttcagg aggttatgtc gcttagcgat cgtattatag tgatgtttcg aggtgagttg      1440
     atgggagatg tagctggtga aggaacggat gtttcaacga tcggcaggat gatgttagga      1500
     gaaactttgg agttagacaa atga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page