(data stored in ACNUC7421 zone)

EMBL: CP002116.PE118

CP002116.PE118       Location/Qualifiers
FT   CDS_pept        125602..126717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0120"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   cyt:cce_2447 permease protein of sugar ABC transporter;
FT                   PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79278"
FT                   /db_xref="GOA:E1R8D4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D4"
FT                   /protein_id="ADK79278.1"
FT                   /translation="MTKIKRPGILNLPGIGEVVLSSARPLLGIFLGLLAGALLIAISGV
FT                   NPFVAYWAMVQGAFGSPQAFANVLVRASPLLLAGVGVAIGIKAGIWNIGAEGYMYAGAI
FT                   GAAVVGIAPLSVHPFIHILLSVIAAMVFAAVWGLLPAFLRAYKGLNEVVTTIMMNYVAI
FT                   AFTSWLVHPPVFMAEPDSFFPMSLMIKPSAKIPFLMKGTSLHPGFIFGIIACIICFLVI
FT                   RYTPFGFRTRMLGVNPEASRYAGLNEKRQIMLVMLIGAVMGGVAGAFEVLGLKTRLYMD
FT                   FVSGVGYEAVAVALLSAGNPLGVIGSAFFFSALKAGGATMSIVTGVGKPMTIVIEALCV
FT                   LFVIALGYHKRKRLKREDKEIEDEEVQKGEQ"
     atgactaaaa ttaaacgacc tggaatattg aatttaccgg gtattggaga agttgtctta        60
     tcaagcgcac gccctctcct cggcatcttt ttaggtttgc tggctggagc actattaatt       120
     gctatttcgg gagttaatcc ttttgtggca tattgggcga tggtgcaggg ggcttttggg       180
     agtcctcagg catttgcgaa cgtgctggta cgtgcttccc ccctgcttct tgccggcgtg       240
     ggtgtagcaa tcggtatcaa ggcgggtata tggaatattg gtgcagaagg atatatgtat       300
     gctggtgcaa tcggtgctgc agtagtcggg atcgcaccat tatctgttca tccctttatt       360
     catattctgc tttccgtcat cgcagccatg gtatttgcag ctgtttgggg attacttccc       420
     gcattcctgc gtgcctataa gggattaaac gaagtcgtta caacaataat gatgaattac       480
     gtggccattg catttaccag ctggctggtg caccctcccg ttttcatggc ggaaccggac       540
     tcctttttcc ccatgtcctt aatgattaaa ccttcagcaa aaataccctt tttaatgaaa       600
     gggaccagtt tgcatccagg tttcatcttt ggaattattg catgtattat ttgcttttta       660
     gtaatccgtt acacaccatt tggttttaga acacgtatgc tgggcgtaaa ccccgaagca       720
     tcccgctatg ccggtctaaa tgagaagcgt cagattatgc ttgttatgtt gataggggca       780
     gttatgggtg gcgttgccgg tgcatttgaa gttttaggac ttaaaacacg tttgtatatg       840
     gactttgtgt cgggagtggg gtatgaagcg gtagctgtcg ccctcctgtc tgccggaaat       900
     cctctgggag tcattggcag tgcatttttc ttttcagcct taaaagcagg cggtgctaca       960
     atgtctattg tgaccggagt aggaaaaccg atgactattg tcattgaagc tctgtgtgta      1020
     ctcttcgtga ttgcattggg atatcataaa agaaaacgcc tgaagcggga agataaagaa      1080
     attgaagatg aagaggtaca aaaaggtgaa cagtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page