(data stored in ACNUC7421 zone)

EMBL: CP002116.PE12

CP002116.PE12        Location/Qualifiers
FT   CDS_pept        complement(9730..10791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0012"
FT                   /product="metallophosphoesterase"
FT                   /note="InterPro IPR004843; KEGG: cch:Cag_0430 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79172"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P0"
FT                   /protein_id="ADK79172.1"
FT                   /translation="MNKQFYHLKLEELYTKAKEIEIHDNQRFVIFSDLHVGNGKYGDDF
FT                   RPNAKLFQTALHDYYYEKGYTLILNGDIEELHRYTLAEIRSTWKSLYSLFDAFDAENRL
FT                   YKLSGNHDSKLFNLPGEPLRYKLYESLKLNYKGMTLFLFHGHQPSYFYEKFNEISGLLL
FT                   RFIAKPLRIKHYSVAHDKGRRFKIEKRTYEFSIEKNIVSIIGHTHRPLFESLSKLDSLK
FT                   YKIENLLRRYAKSGDEKQKFLEKQIEEIKKEIDKSIMTKGKEQAISSLYSSQTLAPSVF
FT                   NSGCVIGKRGMTAIEIKGGKISLVHWFNEDVDEKYRKNDGKNTSQLDNTGFFRTVLKRD
FT                   SLDYIFTKIRLLT"
     atgaacaagc aattctatca tctcaagctc gaagagcttt acacaaaggc aaaagagatt        60
     gagatacatg acaatcagcg gtttgtcatc ttcagcgatc ttcacgtcgg aaacgggaaa       120
     tatggagacg actttcgtcc caatgccaaa ctcttccaga ccgctctcca tgactactac       180
     tatgaaaaag gatataccct catcctcaac ggagatattg aggagctcca tcgttataca       240
     cttgccgaaa tccgctctac atggaagagc ctatattcgc tttttgatgc attcgatgcg       300
     gaaaatcgcc tttataagct ttcgggtaat catgattcga aactttttaa cctccctgga       360
     gagcccctac gctacaaact ctacgaatca ctcaagttga attataaggg tatgacgctt       420
     tttctcttcc atggccatca gcccagctat ttttacgaaa aattcaatga aatatcgggc       480
     cttttgctcc gcttcattgc aaaaccctta cgaatcaaac actattcggt cgcacacgat       540
     aaaggcaggc gctttaaaat cgaaaagcgg acctacgaat tctccattga aaaaaacatc       600
     gtatccatca tcggccatac ccatcgcccc ctttttgaat ccctttcaaa actcgactct       660
     cttaaataca aaatcgaaaa tcttctgcgc agatatgcaa aatccggtga cgaaaaacaa       720
     aagtttcttg aaaagcaaat cgaggaaatc aaaaaagaga tcgacaaatc catcatgaca       780
     aagggcaaag agcaggcaat aagttctttg tacagcagcc agacccttgc tccttccgtt       840
     tttaattccg gctgcgtaat cggaaagcga ggaatgacgg cgatagaaat caaaggagga       900
     aaaatatcgc ttgttcactg gttcaatgaa gacgtcgatg aaaaataccg gaaaaacgac       960
     gggaaaaaca cctctcaact ggataacacc ggtttttttc gaacggtact aaaacgagac      1020
     tctcttgatt acatcttcac caaaatcaga cttctcacat aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page