(data stored in ACNUC7421 zone)

EMBL: CP002116.PE120

CP002116.PE120       Location/Qualifiers
FT   CDS_pept        127941..128690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0122"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663; KEGG: btl:BALH_3421 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Transcriptional regulators; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79280"
FT                   /db_xref="GOA:E1R8D6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D6"
FT                   /protein_id="ADK79280.1"
FT                   /translation="MIKYPKVSDELLSVKVKKILFKMMKDGEFDKTGRLPSEAEIADKL
FT                   SVSRTVIRDVYRLLETEGYIIRRRGIGTLINYNVLYIKERLDVDHVDEFYNLVRESNNT
FT                   PETRFLEYCELAATPELAERFNIEPGDLLICLKRVITADGIPVIYCENYFPKVFLCKKI
FT                   SSENDFKRPIFEFMEHYCNMRIHHEIANIKPILLSKKMISIFNIENTEPALKLQEISYN
FT                   IEQQPILYSYEFHRSGILEHTLLRKRI"
     atgattaaat acccaaaagt tagcgatgaa ttgctatcag taaaggtgaa aaaaatactc        60
     ttcaaaatga tgaaagatgg agagtttgat aagacagggc gtcttccgtc cgaggcagaa       120
     attgcagata aactcagtgt tagtagaact gtaattcgtg atgtttaccg gttgctggaa       180
     actgaaggat acattattcg gcgtagggga ataggcaccc ttataaatta caacgttctt       240
     tatataaaag aacgtcttga tgtagatcat gtggatgagt tttataattt ggtccgggaa       300
     tctaataata ctcctgaaac gagatttctg gagtattgtg aattggccgc tactcccgaa       360
     ttggcagagc gattcaatat tgaaccgggt gaccttctca tatgtttaaa aagagtgata       420
     acagcggatg gtattccggt aatatactgc gaaaactatt tccctaaggt gtttctttgt       480
     aaaaagataa gttcggagaa tgattttaaa aggccgattt tcgagttcat ggaacattat       540
     tgtaatatgc ggatccatca tgagatagcg aacatcaaac cgattcttct ttccaaaaaa       600
     atgatttcaa tttttaatat tgaaaatact gaaccagctt taaagttaca agagattagt       660
     tataatattg agcagcaacc gattctttac tcgtatgaat ttcatcgttc aggaattctt       720
     gagcatactc tacttcggaa aaggatttag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page