(data stored in ACNUC7421 zone)

EMBL: CP002116.PE121

CP002116.PE121       Location/Qualifiers
FT   CDS_pept        128879..129154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0124"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cth:Cthe_0590 transposase
FT                   IS3/IS911; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: Transposase IS3/IS911; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79281"
FT                   /db_xref="GOA:E1R8D7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D7"
FT                   /protein_id="ADK79281.1"
FT                   /translation="MSKRRRKFTSEQKFQIVIEAIKGERQISEIAAQYQVHPNQISNWK
FT                   KQFLEKGATVFNTKADDSKKILEETQEDLFKKIGQQQYEIEWLKKT"
     gtgtccaaga gaagaagaaa atttaccagt gaacaaaagt tccagattgt aatagaagca        60
     atcaaaggcg aacggcaaat ttctgaaatc gcagcgcagt atcaggttca tcccaaccag       120
     atcagcaact ggaagaagca atttcttgaa aagggagcaa ctgtttttaa tacaaaggca       180
     gatgattcca agaagattct ggaagaaaca caggaagatc ttttcaagaa aattggccag       240
     cagcaatacg agatcgagtg gttaaaaaaa acttga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page