(data stored in ACNUC7421 zone)

EMBL: CP002116.PE122

CP002116.PE122       Location/Qualifiers
FT   CDS_pept        129183..129998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0125"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: glo:Glov_3665
FT                   integrase catalytic region; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79282"
FT                   /db_xref="GOA:E1R8D8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D8"
FT                   /protein_id="ADK79282.1"
FT                   /translation="MISPDEKLSISRQCKLVSLNRSSLYYKSMPVKGENIELMKRIDEL
FT                   YTDNPDFGSRQIRNSLRREGRKINRKRVQRLMRDMGIMAIFPGRNLSKPGIGSEHKVYP
FT                   YLLRKLSISRPNQVWATDITYIRLAHGFVYLVAIIDWYSRKILSHEISTTMDQEFCISA
FT                   YRMAITQYGNPEILNSDQGSQFTSKEYRKLVLGSGATFSMDGKGRALDNIAIERFWRTL
FT                   KYGEVYLKEYESVREAKDGIKALIEKYNSRRPHTKHGISTPDEVFGVAA"
     atgatatcac ctgatgaaaa gctatcgata tcacggcagt gcaagctggt gtctctgaat        60
     cgcagctccc tctattacaa gagcatgcct gttaaaggcg agaacataga actcatgaaa       120
     aggattgatg aactatatac cgataatccc gactttggta gtcgccaaat acgcaacagc       180
     ctgcgtcgag aaggaaggaa aatcaacagg aaaagagtgc agcgattgat gcgcgacatg       240
     ggaattatgg cgatttttcc tggaagaaac ctttcaaaac ccggtatagg gtcagagcat       300
     aaagtctatc cgtacctctt gagaaagctg agtatcagcc gaccaaacca agtgtgggct       360
     acagatatta cctatatccg gcttgctcat ggttttgtct atctggtcgc gatcattgac       420
     tggtatagcc ggaaaatcct cagtcatgaa atctctacca ctatggatca agagttctgt       480
     atctctgcat atcgaatggc gataactcaa tatggtaatc cggaaatctt gaactccgat       540
     caggggagcc aatttacctc aaaagaatac agaaaattag tcttgggttc cggggctaca       600
     ttcagcatgg atggcaaagg aagagcattg gacaatattg caatagaaag gttctggcga       660
     accctgaaat atggagaagt gtacctcaag gaatatgaat cagttaggga ggcaaaagac       720
     ggtataaaag cgctcattga aaagtataac agcaggcgtc cgcataccaa gcatggtatt       780
     tccacgccgg atgaagtatt tggagtggca gcataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page