(data stored in ACNUC7421 zone)

EMBL: CP002116.PE123

CP002116.PE123       Location/Qualifiers
FT   CDS_pept        complement(130540..131487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_0238 flagellar cap protein; SPTR:
FT                   Flagellar cap protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79283"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D9"
FT                   /protein_id="ADK79283.1"
FT                   /translation="MKKLLTALVLSMILFGCSTSIPVQMTVPPNLNYGGARTIGVIPFT
FT                   TSSEDASEATKDLRYYFSWYNSRALHDDLKLASALTSKVESVLASSDYFTVISTEQLQQ
FT                   QAANGTITAEAVVTGKIASVLDDYNKEYNERTDADGNTTKVPEYTREAQITVVFKILSA
FT                   SDLTVLDTIEYTVTAKDTANKYEALKSKEAVRFQAIDRIVNKVTYDLIPKTYTEYRTMA
FT                   KLENDKDPRVERINDLIKGDFYQEAYDLYMEIYSETSDFAALYNAILLTEVMGDYDKAL
FT                   DDMTQLAKTSGDKRAIAQMNRMKKQKADREALGE"
     atgaaaaagc ttctcactgc attagtgctc agcatgattt tatttggctg cagcacatcc        60
     attcctgtcc agatgaccgt ccctcccaat ctaaattatg gtggtgcccg taccatcgga       120
     gtcatcccct ttaccacatc ttctgaagat gcctcggaag caacaaagga cttacggtat       180
     tatttttcct ggtacaatag cagagcatta catgatgatt tgaagttggc ctctgccctg       240
     acaagtaagg ttgagtcggt tttagcttct tccgattact ttacggttat ctcaacagaa       300
     caactgcagc agcaggcagc aaatggcacc attacagcag aggctgtcgt gacaggaaag       360
     attgcttcgg tactggatga ttacaataaa gaatataatg agagaaccga tgccgacggc       420
     aatactacca aagtaccgga atacacacga gaagcccaaa taacagttgt tttcaaaatt       480
     ctttcggcgt ccgacctcac cgtcctcgat accattgagt acacggtaac tgcaaaggat       540
     accgctaata aatacgaagc cctcaaatca aaggaagctg tacgattcca ggccatcgat       600
     cgaatcgtga ataaagtaac atatgatctc attcccaaga cctataccga atatcgaaca       660
     atggcgaagc ttgaaaatga taaggacccc cgtgtagaga ggattaatga cctcatcaaa       720
     ggagattttt accaagaagc ctatgatctg tatatggaga tctacagtga aacctcggat       780
     tttgctgcct tgtacaacgc aatactgtta accgaagtga tgggcgatta cgataaggct       840
     cttgatgata tgactcagtt ggctaaaact tcgggagaca aaagagcaat tgcccagatg       900
     aatcggatga aaaagcagaa ggccgataga gaggcccttg gagaataa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page