(data stored in ACNUC7421 zone)

EMBL: CP002116.PE124

CP002116.PE124       Location/Qualifiers
FT   CDS_pept        complement(131721..132242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0127"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1247 Sortase and related acyltransferase;
FT                   InterPro IPR000182; KEGG: rcu:RCOM_1843230 hypothetical
FT                   protein; PFAM: GCN5-related N-acetyltransferase; SPTR:
FT                   GCN5-related N-acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79284"
FT                   /db_xref="GOA:E1R8E0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E0"
FT                   /protein_id="ADK79284.1"
FT                   /translation="MKLIDCGRSFASSILDIYNEAIIHSTALYDYKPRTIESMGTWFDD
FT                   KEKKGFPIIGLVDDKNRLIGFGTYGNFRARPAYHYTVEHSIYIQKEYRGCGYGELLLRE
FT                   IIAKAAEQDYHCLIAGIDSENAASIHLHKKLGFSLCGELKQVGYKFGRWLNLVFYQLIL
FT                   PTPQEPQREI"
     atgaaattaa ttgattgcgg caggagcttt gcttcctcga tcttggatat ttacaatgaa        60
     gcgattatcc actcgacagc cttgtacgat tacaaaccaa gaacaatcga atcgatggga       120
     acctggttcg acgacaaaga gaaaaaggga tttccgataa taggtcttgt tgatgataag       180
     aatcggctga tcggtttcgg aacctatggg aatttcaggg ccagacccgc ctaccattac       240
     acggtggagc attcgatcta cattcagaaa gaataccggg gatgcggata tggagagctt       300
     ttgctccgcg aaattatcgc taaggcagca gaacaggatt atcattgcct tatagctgga       360
     atcgattcag aaaacgcagc ctcgattcat ctccacaaaa agctgggctt ttctttatgc       420
     ggagaactta aacaagtagg ttacaaattt ggaagatggc ttaacctggt cttctatcaa       480
     ctgatacttc cgaccccaca ggagccccaa agagaaattt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page