(data stored in ACNUC7421 zone)

EMBL: CP002116.PE125

CP002116.PE125       Location/Qualifiers
FT   CDS_pept        complement(132244..133020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0128"
FT                   /product="putative esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   bbe:BBR47_31170 hypothetical protein; PFAM: putative
FT                   esterase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79285"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E1"
FT                   /protein_id="ADK79285.1"
FT                   /translation="MILRGSFFSQILEMETGLSILIPNRTIDTPPYRVAYLLHGLCGRN
FT                   GDWLDYTMLPAYAEVFDIMFIMPEVARSFYTDMVFGQKFFTYIHQELPVIVKKVFNISA
FT                   KREDTLVIGASMGGYGALKCALSYPDQYGYCAAFSSACLFLKEGLERQQRYGKTAEMEK
FT                   QYGKQLLNDFESIFGQALEWKPEYELLELAKSRPAPPRLYLACGTADHLKDENQRFSHE
FT                   LEKLNIPHRYEEWPGGHDWNFFNKALEKALRGINEV"
     atgatattac gaggatcttt tttttcacaa atacttgaaa tggaaacagg cctttcaata        60
     cttatcccca atagaaccat agacactccc ccatacaggg tcgcctatct tttgcacggc       120
     ctttgcggca gaaacggaga ctggctggat tacacaatgc ttcctgccta cgccgaagta       180
     ttcgacatca tgttcatcat gcccgaagtg gcaagaagtt tttataccga tatggtcttc       240
     ggccagaaat tcttcaccta cattcatcag gagctacccg tcattgtcaa aaaagttttc       300
     aatatatcgg caaaaaggga agacaccttg gttatcggtg cttcaatggg gggatacggt       360
     gcattgaaat gcgcgctttc ctatcccgat cagtatggct attgtgcagc cttctcttct       420
     gcctgccttt tcctgaagga agggctggaa aggcaacaac gctatgggaa gacagcggaa       480
     atggaaaaac agtatggcaa gcagcttctc aacgattttg agtcgatatt cggtcaggca       540
     ttggagtgga aaccagaata cgagctgctc gaactggcaa agtcaagacc agcccctccc       600
     cgactctatc tggcctgcgg aacagcagat catttgaaag atgaaaatca acgcttctcg       660
     cacgaattgg aaaagctaaa tattccccac cgttacgaag aatggccagg tggtcatgac       720
     tggaattttt tcaataaggc tttggaaaag gccttgagag gaataaacga ggtttga          777
//

If you have problems or comments...

PBIL Back to PBIL home page