(data stored in ACNUC7421 zone)

EMBL: CP002116.PE126

CP002116.PE126       Location/Qualifiers
FT   CDS_pept        133393..134100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0129"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="InterPro IPR018060:IPR000005; KEGG: ppf:Pput_2324
FT                   AraC family transcriptional regulator; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: AraC-like ligand binding
FT                   domain; Bacterial regulatory helix-turn-helix proteins,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79286"
FT                   /db_xref="GOA:E1R8E2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E2"
FT                   /protein_id="ADK79286.1"
FT                   /translation="MIKILRYCSDPVCELKWGWGEHAVRKHAHSLWSFSIVLSGRTQIA
FT                   LGRDRAILSAGSSIAIPSGVAHLCTPEKEPPFTFAVLYCDERWLKTCGVDSDRILWGRL
FT                   GAQEFQEMLHTSKGTEAGRMLGSLLQRFERILPDVDRLTFPKNADSGFAPVSIRSTSEN
FT                   RFKAYRQYAQRYSLGPHAVRQNRRIELAKAALRTGLSVAETAAACEFYDQSHFVKTFRL
FT                   YTGTTPSLYKKGI"
     atgataaaaa tcctacgata ttgttccgat cctgtatgcg agttgaaatg gggctgggga        60
     gaacacgctg ttagaaagca tgctcatagc ctctggtctt ttagcattgt tttgtcgggc       120
     cgaacgcaga ttgcgcttgg tagagatcga gcgatcctgt cggccggcag ttccattgcg       180
     attccaagtg gggttgctca tctctgtacg ccggaaaagg aacctccttt tacctttgcc       240
     gttctttact gtgacgaaag gtggttgaag acgtgtggag ttgattcaga ccgtatcctt       300
     tgggggcggc tcggtgcaca ggagtttcag gaaatgctgc atacatcgaa gggaactgaa       360
     gctggtagga tgttgggatc cctcttgcag cgcttcgaaa gaatcctgcc ggatgtggat       420
     cggcttacct ttcccaagaa tgcagattcg gggtttgccc ctgtttccat taggtcgaca       480
     tctgagaacc gcttcaaggc gtatcggcaa tatgctcagc gttattcttt aggtccccat       540
     gctgttcggc agaataggcg tatcgagttg gcaaaagccg ccttacgtac ggggctatcc       600
     gttgcggaaa cagctgcagc ctgcgaattt tacgatcaaa gccattttgt taaaaccttc       660
     cgcctttata ccggcaccac cccttcatta tacaaaaagg gcatatag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page