(data stored in ACNUC7421 zone)

EMBL: CP002116.PE127

CP002116.PE127       Location/Qualifiers
FT   CDS_pept        134162..134563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0130"
FT                   /product="Protein of unknown function DUF2000"
FT                   /note="InterPro IPR018988:IPR017021; KEGG:
FT                   cdl:CDR20291_1132 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2000; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79287"
FT                   /db_xref="InterPro:IPR017021"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E3"
FT                   /protein_id="ADK79287.1"
FT                   /translation="MKAAIIVDTALPLGLIANSAAVLGASLGALHPEIIGEDLADLSGR
FT                   RHAGITGLPIPILGADKERLRKLVDSAEHDDDIDFIAFNDVAQRCKSYKEYSELLATVP
FT                   SDTLRYLALLVVGKKQAVNRLTGSLPLAK"
     atgaaagctg ccatcattgt agacactgct cttcccttag gcttgatcgc taattctgct        60
     gctgtacttg gggcctcgct tggggcattg catcctgaaa ttatcggtga ggaccttgcc       120
     gacctatcgg ggcgcagaca tgcgggtata accggccttc caattcccat tcttggagca       180
     gataaagaac gacttcgcaa gctggtagac agcgcggagc atgatgatga tattgatttt       240
     attgccttta acgatgtggc acaacgatgc aagagctata aggagtattc ggaattattg       300
     gcaacggtcc cttcggatac acttcgttat cttgcgcttc ttgttgtagg aaaaaaacaa       360
     gcggttaaca ggcttaccgg ttctttaccc ttggcgaagt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page