(data stored in ACNUC7421 zone)

EMBL: CP002116.PE128

CP002116.PE128       Location/Qualifiers
FT   CDS_pept        complement(134625..135299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0131"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: ckr:CKR_0542 hypothetical
FT                   protein; PFAM: YheO domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79288"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E4"
FT                   /protein_id="ADK79288.1"
FT                   /translation="MNDAMKKQYSIIVEFLGKALGPDYEVVLHDVDDHINSIVAIANGH
FT                   VSHRSVGGPMTNFGLEVISEERYKKEDYKINYNGISKDQRILRSSTLFIKDEKDEIAGL
FT                   LCINFDDRRYKALSENILKLCHPDKLVELNTSYDSSTIVDNAEERFYGSAAEEISSVLD
FT                   KYLSENGIPSDRLSQDDRLHVVDILNQKGIFMVKGAVKEAAKQLACSEPTIYRYINKVN
FT                   NE"
     atgaacgatg ccatgaaaaa gcagtacagc atcattgtcg aatttctggg taaagctttg        60
     ggaccggact atgaggtggt tcttcatgat gtcgacgatc atatcaattc cattgtggca       120
     atcgcaaatg gccatgtaag ccatcgcagc gtcggcgggc cgatgacgaa ctttggcctc       180
     gaagtcatat cagaagaacg gtataaaaaa gaagattaca agataaacta taatggcatt       240
     tcaaaggacc aaaggatttt aagatcctcc actcttttca tcaaggatga aaaagatgag       300
     attgcaggac ttctttgtat caatttcgac gatagacgat ataaagcgtt aagcgaaaat       360
     atactgaagc tatgccatcc ggataagctc gtagaactga atacgtcgta cgattccagt       420
     acgattgtcg ataatgcgga agaacgcttt tacggttcag ccgccgaaga aattagtagt       480
     gtactggaca aatatcttag tgaaaacggt attccctcgg atcgattatc gcaggatgat       540
     cgtctgcacg tcgtcgacat ccttaatcag aaaggaattt tcatggtaaa aggagcggta       600
     aaagaggcgg cgaagcaact tgcctgttca gaacccacta tctatcgcta tatcaacaag       660
     gtaaataatg agtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page