(data stored in ACNUC7421 zone)

EMBL: CP002116.PE129

CP002116.PE129       Location/Qualifiers
FT   CDS_pept        complement(135466..136797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0132"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: ctc:CTC01190
FT                   sodium-dependent amino acid transporter (proline,
FT                   tryptophan); PFAM: sodium:neurotransmitter symporter; SPTR:
FT                   Transporter; PFAM: Sodium:neurotransmitter symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79289"
FT                   /db_xref="GOA:E1R8E5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E5"
FT                   /protein_id="ADK79289.1"
FT                   /translation="MDDKSAEITRDSFNTRIGFILACIGSAVGMANLWLFPYRIGQFGG
FT                   AAFLIPYCLSIIVIGLVGVIGEMSFGRAMRTGPLGSFKKAFLRRGKKHGELLGLIPVIG
FT                   SLGIAIGYAVVVGWILRFVVGSITGAVINTTDSAAYFGKIAGPLGSIGWHFTGLALTFV
FT                   IMLMGIAKGIEKVNKFMMPTFFILFVLLAIRVLTLPGSIEGYRYLFIPKWELLAKPKTW
FT                   VYALGQAFFSLSLAGSGTVVYGSYLKNTEDVVSCAKNVALYDTIAALLAAIVILPAVFV
FT                   FHLDPTAGPPLMFITMPNVFKMMPMGYLFSIIFFVAVLFAGISSLMNLLETPVEAIQQR
FT                   FKVSRGTAIAVVAIISASAGLILENGSTLGTWMDIVSIYIIPLGALLSGIMFFWVCGPG
FT                   FARQQAQTGRKKKIGRWFEPMTKYVFCGFTILIYILGILYGGIG"
     atggatgaca aaagtgcaga aattacccgt gacagcttta atacacgaat aggttttatt        60
     ctggcctgta tcggatccgc cgtcgggatg gcaaatttgt ggctgtttcc ctaccgaatc       120
     gggcaattcg gtggagccgc ttttctcata ccctactgcc tttccattat cgttataggt       180
     ctggtgggag tcattggaga aatgtccttc ggtcgggcaa tgagaacagg gccattgggg       240
     tccttcaaaa aggcatttct acgcagaggc aaaaaacacg gagagctttt gggccttata       300
     ccggtcatag gctccctcgg tatcgccatt ggctacgcgg tcgtcgttgg ttggatacta       360
     cgttttgtag tgggatctat taccggagcc gtgatcaata caacagacag cgccgcatat       420
     ttcggcaaga ttgcaggccc gctgggaagt atcggctggc attttaccgg cctggcctta       480
     acctttgtaa ttatgcttat gggaattgcc aaaggcatag aaaaagtgaa taaattcatg       540
     atgcctacct ttttcattct ttttgttctt ctagcgattc gagtcctcac gcttcccgga       600
     tcaatcgaag gctataggta tctttttatt cctaagtggg aacttcttgc aaaacctaaa       660
     acctgggtat acgccctcgg ccaggcattt ttctctcttt cacttgcagg atccggaacg       720
     gtagtgtacg gaagctatct aaagaataca gaagatgtcg tcagctgcgc gaaaaacgtg       780
     gccctctacg ataccattgc tgcgctgctt gccgcgatcg taattcttcc cgcagtcttt       840
     gtcttccacc tcgatccgac agcaggacct ccattgatgt tcatcaccat gccgaatgtc       900
     ttcaagatga tgccgatggg ctacctattt tccatcattt ttttcgttgc agtactcttt       960
     gccgggatca gctcgcttat gaacctgctt gaaaccccag tcgaagcaat ccaacaacga      1020
     tttaaggtat caagaggtac ggcaattgcc gttgtcgcaa taataagtgc aagtgcaggg      1080
     ctcatcctgg agaatgggtc gacgttgggc acatggatgg atattgtatc aatttatatt      1140
     atacctctag gcgcattgct ttccggaatc atgtttttct gggtctgcgg gccgggattc      1200
     gcacgtcagc aagcccagac aggccgcaaa aagaaaatcg gcagatggtt cgaacctatg      1260
     acaaaatatg tgttctgcgg ttttacaatt cttatttata ttcttggtat tttgtacggc      1320
     ggcattggtt ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page