(data stored in ACNUC7421 zone)

EMBL: CP002116.PE13

CP002116.PE13        Location/Qualifiers
FT   CDS_pept        complement(10866..11339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0013"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178; KEGG: cca:CCA00348 PTS system,IIA component;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; SPTR: PTS system,IIA
FT                   component; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79173"
FT                   /db_xref="GOA:E1R6P1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P1"
FT                   /protein_id="ADK79173.1"
FT                   /translation="MVTLCRLIGKNGICQLSKTNKSQAILELISHARQFANKPWADDFY
FT                   CEVMRKELLQSTGLGKGIAVAHGTCQGIDQVYVALGISQEGIEYDAIDSQPVHLLFLVA
FT                   NPPETQLEYLSALSTLVRLLRNDSFREKIMHCVTAEQVYLLFKQRGCTIPIRT"
     atggttacct tatgcaggtt gattgggaaa aacggcatct gtcagctatc caagacaaat        60
     aagtcccagg ccattctcga gctcatttca catgcaagac aatttgcaaa caaaccttgg       120
     gctgacgatt tctattgtga agtaatgaga aaggagctgc tacagagcac cggtctcggc       180
     aagggtattg cggttgctca cggaacctgt cagggaatcg atcaagtcta cgttgccttg       240
     ggaatcagtc aggaaggaat tgagtatgat gccattgatt ctcaacccgt ccaccttctt       300
     tttcttgttg caaatcctcc ggaaacacaa ttggagtatt taagcgccct ctcaaccctt       360
     gtccgtttgc tccgcaacga ttcattcagg gaaaaaatca tgcactgtgt tacagccgag       420
     caggtttacc ttctttttaa gcagcgtggc tgcaccatcc cgatacgaac atag             474
//

If you have problems or comments...

PBIL Back to PBIL home page