(data stored in ACNUC7421 zone)

EMBL: CP002116.PE130

CP002116.PE130       Location/Qualifiers
FT   CDS_pept        complement(136871..138253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0133"
FT                   /product="Tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro
FT                   IPR001597:IPR011166:IPR018176; KEGG: ctc:CTC01509
FT                   tryptophanase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tryptophanase; SPTR:
FT                   Tryptophanase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tryptophanase, leader peptide-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79290"
FT                   /db_xref="GOA:E1R8E6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013440"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E6"
FT                   /protein_id="ADK79290.1"
FT                   /translation="MAITYLPEPFRIKMVETIKMLTPEEREQRIAEAKYNLFNLKGKDV
FT                   YIDLLTDSGTNAMSQEQWAGVMKGDEAYAGGASYYKLLEAAQDITGYAYIQPVHQGRAA
FT                   EKVLFGILMGKGQFSISNMHFDTTRAHVELTGARAIDCVVSDAMDPAKRAPFKGNMDVD
FT                   KLESLIKKYGAEKVALVVMTVTNNSAGGQPVSMQNIRETASVCKKYNIKFCIDAARFAE
FT                   NAFFIKKREDGYRDASIKDITNEMFSYADMFTMSAKKDAIVNMGGLIGIKDDAELFSAC
FT                   KGRTISFEGFITYGGLSGRDLESLAIGLYEGIDENQLRYRIGQIEYLASRLDDAGITYQ
FT                   APAGGHGIFVDAKALLPHIPYYEFPGQALAVELYKEAGIRTCDIGSYMLGNDPDTGKQL
FT                   HAEFEFTRLAIPRRVYTQAHIDVMAEALIEIKKRANRVKGYKITWEPPVLRHFQASLKP
FT                   LT"
     atggcaataa catatttacc agaaccgttt agaatcaaaa tggttgaaac aattaagatg        60
     cttacccccg aagaacggga acaaaggatt gctgaagcaa aatacaacct cttcaatctt       120
     aaaggaaaag atgtctatat cgacctactg accgacagcg gtaccaatgc aatgagtcag       180
     gaacaatggg ccggggtcat gaaaggcgac gaagcctatg ccggcggtgc cagctattac       240
     aaacttctcg aggcagccca ggatatcacc ggttatgcat acatccagcc ggtccatcag       300
     gggcgggcag ctgaaaaggt tcttttcggc attctgatgg gaaaaggcca gttttcgatt       360
     tccaacatgc attttgatac aactagagcg cacgtcgaac ttaccggagc gagggccatc       420
     gattgtgtgg tttccgatgc tatggatcct gccaaacggg caccattcaa agggaatatg       480
     gacgttgaca agctagaatc actaattaaa aaatacggag ccgaaaaggt cgcgcttgtc       540
     gtcatgaccg ttaccaacaa ttcggcagga gggcagccgg tatcgatgca aaacatccga       600
     gaaacggcat cggtttgcaa gaaatataat atcaagtttt gtattgatgc agcacgtttt       660
     gcagaaaacg cctttttcat caaaaagcgg gaagatggtt atcgtgatgc ttcgattaaa       720
     gatattacca atgaaatgtt ctcctatgca gatatgttta ccatgagtgc aaaaaaagat       780
     gccattgtaa acatgggagg ccttattggt ataaaggatg atgccgaact tttttcggcc       840
     tgcaagggga gaaccatatc gttcgagggc tttataacct acggaggtct ttcgggacgg       900
     gatcttgaaa gccttgcgat aggcctttac gaaggaatcg acgaaaatca gttgcgttac       960
     cgaatcgggc aaatagaata tctcgccagt cgcttggatg atgcggggat cacctaccag      1020
     gcaccggccg ggggacacgg catctttgta gatgcaaagg ccttgttgcc ccatattccc      1080
     tattatgagt tccctggtca ggcgcttgcc gtggaactct acaaagaggc cggtattcga      1140
     acatgcgaca taggctcgta catgcttggc aacgatcccg ataccggtaa acaacttcac      1200
     gcggaatttg agttcaccag actcgccatt cccagaaggg tctacactca ggcccatatc      1260
     gacgtaatgg cagaagcatt aatcgagata aagaagaggg caaatagggt aaaaggctac      1320
     aaaatcacct gggaacctcc tgtcttgcga cattttcagg caagccttaa gcctcttaca      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page