(data stored in ACNUC7421 zone)

EMBL: CP002116.PE131

CP002116.PE131       Location/Qualifiers
FT   CDS_pept        complement(138283..138666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0134"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR006175:IPR019897; KEGG: tde:TDE2069
FT                   endoribonuclease L-PSP, putative; PFAM: Endoribonuclease
FT                   L-PSP; SPTR: Translation initiation inhibitor protein;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP; TIGRFAM: endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79291"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E7"
FT                   /protein_id="ADK79291.1"
FT                   /translation="MIKRIVTEKAPPAIGPYSQAVETDTLIFVSGQLPINPATGCFASA
FT                   EIKGQTQQSVENVKQVLQARGLDLDRVVKTTVFLSDMKNFTSMNEVYREMFDQESVPAR
FT                   SAVEVSRLPKDALVEIEAIAAKN"
     atgataaaac gaattgtaac cgaaaaagct ccgcccgcaa taggccctta ctctcaggcc        60
     gttgaaaccg ataccctaat cttcgtatcg ggacaacttc cgatcaatcc cgctactggt       120
     tgctttgcgt ctgccgagat aaagggccaa acacaacaat ccgtagagaa tgtaaaacag       180
     gtactgcagg cacgaggact cgatttggat cgggtcgtga aaacaacggt atttttaagc       240
     gacatgaaaa atttcacaag catgaatgaa gtatatcggg aaatgttcga tcaagagtct       300
     gtccccgctc gttctgcagt cgaagtttct cgattaccaa aagatgcttt ggtagaaatt       360
     gaagcaattg ctgctaaaaa ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page